DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eRF3 and mIF2

DIOPT Version :9

Sequence 1:NP_001260415.1 Gene:eRF3 / 34658 FlyBaseID:FBgn0020443 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_651621.2 Gene:mIF2 / 43382 FlyBaseID:FBgn0039588 Length:696 Species:Drosophila melanogaster


Alignment Length:409 Identity:99/409 - (24%)
Similarity:158/409 - (38%) Gaps:90/409 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 DGLNPSDKIANNE--TDPADSWDVDDAVI-TPEDEEVEDAEFTEGEATPKVSKKKVVKVEENRSK 192
            |.:.|:.|:|:.:  .:.|........|: |||:...::.:  |.:..|:..     ...|....
  Fly   103 DNIEPAFKLADLKIIQEIAKKLGAKTRVVATPEETNADEQK--ERDVAPRPP-----AAPELLQP 160

  Fly   193 REHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSRESWYLSWALDTNQEERDK 257
            |..| |..:||||.||:|:   :.||.|                           .|....|.. 
  Fly   161 RPPV-VTVMGHVDHGKTTL---LDSLRG---------------------------ADVAAGEAG- 193

  Fly   258 GKTVEVGRAFFET--DRKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKGEFETGFDRGGQ 320
            |.|..:| ||..|  :.:..|.||.|||.:|......||...|:.|||::|..|..       .|
  Fly   194 GITQHIG-AFTVTLENGERVTFLDTPGHAAFSAMRARGAVATDIIVLVVAAEDGVM-------AQ 250

  Fly   321 TREHAMLAKTAGVKHLVVLVNKMDDPTVNWDQTRYNECKDKILPYLKKLGF---NPAKDLTFMPC 382
            |||...|||.|.|. ::|.:||:|.|..|.::::..         |.::|.   ....|:..:|.
  Fly   251 TREVIQLAKEAQVP-IIVALNKIDKPEANIEKSKRE---------LAQMGLALEEHGGDVQVIPI 305

  Fly   383 SGLSGYGLKDQIPETLCPWYRGPAFIPFIDELPSLNRKSDGPFIMP--IVDKYKD--MGTVVMGK 443
            |.|.|..| :.:.|.:.            .:...:..|:|...::.  :|:...|  .|.:....
  Fly   306 SALKGTNL-ELLAEAVS------------TQATLMGLKADPTGLVEGIVVESKTDPRRGKLSTAI 357

  Fly   444 VESGTARKGQNLLVMPNRTQVAVDQLFSDDFEVTSVGPGENVKIKLKGIEEEDVSPGFVLCDAAN 508
            |..||.|||..||  .......|..||..:.:..|..| ....:::.|..|..::...:|     
  Fly   358 VSRGTLRKGSVLL--SGLAHAKVRGLFDHNGQPLSEAP-PGTPVEILGWRELPLAGDLIL----- 414

  Fly   509 PIKTGKIFDAQVVILEHKS 527
            .::|.|...|.:...||:|
  Fly   415 EVETEKKAHAVLKYREHES 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eRF3NP_001260415.1 PAM2 12..28 CDD:284542
TEF1 191..619 CDD:227581 87/346 (25%)
EF1_alpha 197..416 CDD:206670 58/223 (26%)
eRF3_II 424..505 CDD:293906 19/84 (23%)
eRF3_C_III 511..617 CDD:294003 6/17 (35%)
mIF2NP_651621.2 InfB 158..689 CDD:223606 87/347 (25%)
IF2_eIF5B 163..327 CDD:206674 59/226 (26%)
IF2_mtIF2_II 336..431 CDD:293903 22/102 (22%)
IF-2 482..575 CDD:288813
mtIF2_IVc 593..680 CDD:293893
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464690
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.