DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eRF3 and eIF2gamma

DIOPT Version :9

Sequence 1:NP_001260415.1 Gene:eRF3 / 34658 FlyBaseID:FBgn0020443 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001262587.1 Gene:eIF2gamma / 41843 FlyBaseID:FBgn0263740 Length:475 Species:Drosophila melanogaster


Alignment Length:487 Identity:94/487 - (19%)
Similarity:175/487 - (35%) Gaps:137/487 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 NNETDPADSWDVDDAVITPEDEEVEDAEFTEGEATPKVSKKKVVKVEENRSKREHVNVVFIGHVD 205
            |......|..::|.:.:||...||                         .|::..:|:..||||.
  Fly    11 NRNLQKQDLSNLDVSKLTPLSPEV-------------------------ISRQATINIGTIGHVA 50

  Fly   206 AGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSRESWYLSWALDTNQEERDKGKTVEVGRAFFET 270
            .||||:   :.:::|:...|...:.||....|      |.:| :....:.|..|...  .|.|.:
  Fly    51 HGKSTV---VKAISGVQTVRFKNELERNITIK------LGYA-NAKIYKCDNPKCPR--PASFVS 103

  Fly   271 DR---------------------KHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKGEFETG 314
            |.                     :|.:.:|.|||...:..|:.|||..|.|:|:|:..:...:. 
  Fly   104 DASSKDDSLPCTRLNCSGNFRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQP- 167

  Fly   315 FDRGGQTREHAMLAKTAGVKHLVVLVNKMDDPTVNWDQTRYNECKDKILPYLKKLGFNPAKDLTF 379
                 ||.||....:...:|.:::|.||:       |..:.::.|::.....|.:....|:....
  Fly   168 -----QTSEHLAAIEIMKLKQILILQNKI-------DLIKESQAKEQYEEITKFVQGTVAEGAPI 220

  Fly   380 MPCSGLSGYGLKDQIPETLCPWYRGPAFIPFIDELPSLNRKSDGPFIMPIVDKY---------KD 435
            :|.|....|.:     :.||.:        .::::|...|..:.|..:.::..:         .|
  Fly   221 IPISAQLKYNI-----DVLCEY--------IVNKIPVPPRDFNAPPRLIVIRSFDVNKPGCEVAD 272

  Fly   436 M-GTVVMGKVESGTARKGQNLLVMPNRTQVAVD-------------QLFSDDFEVTSVGPGENVK 486
            : |.|..|.:.||..:.||.:.|.|.......|             .||::..|:....||..:.
  Fly   273 LKGGVAGGSILSGVLKVGQEIEVRPGVVTKDSDGNITCRPIFSRIVSLFAEQNELQYAVPGGLIG 337

  Fly   487 IKLKGIEEEDVSPGFVLCDAANPIKTGKIFDAQVVILEHKSIICAGYSAVMHIHCAAEEVTVKAL 551
            :..|      :.|  .||.|...:       .||:            .||..:....:|:.:...
  Fly   338 VGTK------IDP--TLCRADRLV-------GQVL------------GAVGQLPDIYQELEISYY 375

  Fly   552 I---CLVDKKSGDKSKTRPRFVKQDQVAIMRI 580
            :   .|..:..|||...|...::::::.::.|
  Fly   376 LLRRLLGVRTDGDKKGARVEKLQKNEILLVNI 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eRF3NP_001260415.1 PAM2 12..28 CDD:284542
TEF1 191..619 CDD:227581 87/437 (20%)
EF1_alpha 197..416 CDD:206670 51/239 (21%)
eRF3_II 424..505 CDD:293906 20/103 (19%)
eRF3_C_III 511..617 CDD:294003 11/73 (15%)
eIF2gammaNP_001262587.1 PTZ00327 11..465 CDD:240362 94/487 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.