DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eRF3 and eEFSec

DIOPT Version :9

Sequence 1:NP_001260415.1 Gene:eRF3 / 34658 FlyBaseID:FBgn0020443 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_611584.1 Gene:eEFSec / 37444 FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster


Alignment Length:376 Identity:97/376 - (25%)
Similarity:156/376 - (41%) Gaps:99/376 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 NVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSRESWYLSWALDTNQEERDKGKTV 261
            |:..:||||:||:|:...:.|::...                        |.|.|.:..::|.|:
  Fly     6 NIGLLGHVDSGKTTLAKALSSISSTA------------------------AFDKNPQSVERGITL 46

  Fly   262 EVGRAFFETD---------RKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKGEFETGFDR 317
            ::|.:....|         :..||.:|.|||.|.:..:||||...||.:||:.|:||: :|    
  Fly    47 DLGFSGLLVDAPAHLPQGEQLQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKGK-QT---- 106

  Fly   318 GGQTREHAMLAKTAGVKHLVVLVNKMDDPTVNWDQTRYNECKDKILPYLKKLGFNPAKDL---TF 379
              ||.|..::.:.. .|.|:|::||:|....|...::           |:||....||.|   ||
  Fly   107 --QTAECLIIGELL-QKKLIVVINKIDVYPENQRASK-----------LEKLRLRLAKTLEATTF 157

  Fly   380 ---MP-C--SGLSGYGLKDQIPETLCPWYRGPAFIPFIDELPSLNRKSDGPFIMPIVDK---YKD 435
               :| |  |.|.|..:. ::.|.|...|..|            .|....|..| .||.   .|.
  Fly   158 GGQVPICAVSALQGTHIA-ELREVLREAYFQP------------QRNLADPLFM-YVDHCFGIKG 208

  Fly   436 MGTVVMGKVESGTARKGQNLLVMP---NRTQVAVDQLFSDDFEVTSVGPGE---------NVKIK 488
            .|||..|.:..|..:. .|::.:|   .:.:|...|:|..:  |||...|:         |.|:.
  Fly   209 QGTVCTGTLLQGKVQV-NNVIELPALGEQRKVKSIQMFRKN--VTSASMGDRIGLCVTQFNAKLL 270

  Fly   489 LKGIEEED--VSPGFVLCDAANPIKTGKIFDAQVVILEHKSIICAGYSAVM 537
            .:||..:.  :.|.:.:|....||:..|    :|:....|..|..|::.||
  Fly   271 ERGIITQPGYLKPIYAVCLQFKPIRYYK----EVIKSMRKMHISVGHNTVM 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eRF3NP_001260415.1 PAM2 12..28 CDD:284542
TEF1 191..619 CDD:227581 97/376 (26%)
EF1_alpha 197..416 CDD:206670 62/236 (26%)
eRF3_II 424..505 CDD:293906 24/97 (25%)
eRF3_C_III 511..617 CDD:294003 7/27 (26%)
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 63/241 (26%)
SelB 6..467 CDD:225815 97/376 (26%)
SelB_II 196..278 CDD:293897 22/85 (26%)
eSelB_III 283..396 CDD:294009 11/39 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464663
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.