DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5446 and HSBP

DIOPT Version :10

Sequence 1:NP_609565.1 Gene:CG5446 / 34655 FlyBaseID:FBgn0032429 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_849392.4 Gene:HSBP / 827261 AraportID:AT4G15802 Length:86 Species:Arabidopsis thaliana


Alignment Length:72 Identity:38/72 - (52%)
Similarity:49/72 - (68%) Gaps:6/72 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DQNYSLNSNADPKNMQELTIYVQNLLQNVQDKFQTMSDQIITRIDDMGNRIDDLEKSIADLMNQA 77
            |...:..|.||      :|.:||||||.:|.:||||||.|||:|||||.||::||:||.||..:.
plant     5 DSEDTKQSTAD------MTAFVQNLLQQMQTRFQTMSDSIITKIDDMGGRINELEQSINDLRAEM 63

  Fly    78 GIEGQGP 84
            |:||..|
plant    64 GVEGTPP 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5446NP_609565.1 HSBP1 28..78 CDD:429139 30/49 (61%)
HSBPNP_849392.4 HSBP1 14..64 CDD:429139 32/55 (58%)

Return to query results.
Submit another query.