DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5446 and HSBP

DIOPT Version :9

Sequence 1:NP_001260414.1 Gene:CG5446 / 34655 FlyBaseID:FBgn0032429 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_849392.4 Gene:HSBP / 827261 AraportID:AT4G15802 Length:86 Species:Arabidopsis thaliana


Alignment Length:72 Identity:38/72 - (52%)
Similarity:49/72 - (68%) Gaps:6/72 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DQNYSLNSNADPKNMQELTIYVQNLLQNVQDKFQTMSDQIITRIDDMGNRIDDLEKSIADLMNQA 77
            |...:..|.||      :|.:||||||.:|.:||||||.|||:|||||.||::||:||.||..:.
plant     5 DSEDTKQSTAD------MTAFVQNLLQQMQTRFQTMSDSIITKIDDMGGRINELEQSINDLRAEM 63

  Fly    78 GIEGQGP 84
            |:||..|
plant    64 GVEGTPP 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5446NP_001260414.1 HSBP1 28..78 CDD:399661 30/49 (61%)
HSBPNP_849392.4 HSBP1 15..64 CDD:311030 31/54 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 65 1.000 Domainoid score I3638
eggNOG 1 0.900 - - E1_KOG4117
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I2434
OMA 1 1.010 - - QHG56480
OrthoDB 1 1.010 - - D1576489at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto3735
orthoMCL 1 0.900 - - OOG6_103734
Panther 1 1.100 - - LDO PTHR19424
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.