DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5446 and Hsbp1

DIOPT Version :9

Sequence 1:NP_001260414.1 Gene:CG5446 / 34655 FlyBaseID:FBgn0032429 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_077181.1 Gene:Hsbp1 / 68196 MGIID:1915446 Length:76 Species:Mus musculus


Alignment Length:66 Identity:44/66 - (66%)
Similarity:53/66 - (80%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SNADPKNMQELTIYVQNLLQNVQDKFQTMSDQIITRIDDMGNRIDDLEKSIADLMNQAGIEGQGP 84
            :..|||.||::|:.|:.|||.:|||||.||||||.|||||.:|||||||:|||||.|||:|...|
Mouse     2 AETDPKTMQDITLVVETLLQQMQDKFQIMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELDP 66

  Fly    85 E 85
            |
Mouse    67 E 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5446NP_001260414.1 HSBP1 28..78 CDD:399661 35/49 (71%)
Hsbp1NP_077181.1 HSBP1 10..60 CDD:311030 35/49 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845930
Domainoid 1 1.000 77 1.000 Domainoid score I8889
eggNOG 1 0.900 - - E1_KOG4117
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5083
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56480
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto93072
orthoMCL 1 0.900 - - OOG6_103734
Panther 1 1.100 - - LDO PTHR19424
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4388
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.