powered by:
Protein Alignment CG5446 and Hsbp1l1
DIOPT Version :9
Sequence 1: | NP_001260414.1 |
Gene: | CG5446 / 34655 |
FlyBaseID: | FBgn0032429 |
Length: | 86 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001129653.1 |
Gene: | Hsbp1l1 / 66255 |
MGIID: | 1913505 |
Length: | 72 |
Species: | Mus musculus |
Alignment Length: | 46 |
Identity: | 21/46 - (45%) |
Similarity: | 36/46 - (78%) |
Gaps: | 0/46 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 QNLLQNVQDKFQTMSDQIITRIDDMGNRIDDLEKSIADLMNQAGIE 80
:|||..|::.||.::..:..|:::||:||:||::::.|||.|||||
Mouse 19 ENLLLEVEEHFQALTTTLNLRMEEMGSRIEDLQRNVDDLMTQAGIE 64
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG5446 | NP_001260414.1 |
HSBP1 |
28..78 |
CDD:399661 |
17/42 (40%) |
Hsbp1l1 | NP_001129653.1 |
HSBP1 |
14..62 |
CDD:369097 |
17/42 (40%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167845929 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1576489at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR19424 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.950 |
|
Return to query results.
Submit another query.