DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5446 and hsbp1a

DIOPT Version :9

Sequence 1:NP_001260414.1 Gene:CG5446 / 34655 FlyBaseID:FBgn0032429 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_001166105.1 Gene:hsbp1a / 541432 ZFINID:ZDB-GENE-050320-136 Length:77 Species:Danio rerio


Alignment Length:61 Identity:43/61 - (70%)
Similarity:51/61 - (83%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SNADPKNMQELTIYVQNLLQNVQDKFQTMSDQIITRIDDMGNRIDDLEKSIADLMNQAGIE 80
            |..|||:.|:||:.||.|||.:||||||||||||.|||:|..|||||||:|:|||.|||:|
Zfish     2 SEKDPKSSQDLTVVVQTLLQQMQDKFQTMSDQIIGRIDEMSTRIDDLEKNISDLMTQAGVE 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5446NP_001260414.1 HSBP1 28..78 CDD:399661 36/49 (73%)
hsbp1aNP_001166105.1 HSBP1 12..60 CDD:284290 35/47 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590635
Domainoid 1 1.000 79 1.000 Domainoid score I8630
eggNOG 1 0.900 - - E1_KOG4117
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I5101
OMA 1 1.010 - - QHG56480
OrthoDB 1 1.010 - - D1576489at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25554
orthoMCL 1 0.900 - - OOG6_103734
Panther 1 1.100 - - LDO PTHR19424
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.770

Return to query results.
Submit another query.