DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5446 and Hsbp1

DIOPT Version :10

Sequence 1:NP_609565.1 Gene:CG5446 / 34655 FlyBaseID:FBgn0032429 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_775142.1 Gene:Hsbp1 / 286899 RGDID:628632 Length:76 Species:Rattus norvegicus


Alignment Length:61 Identity:42/61 - (68%)
Similarity:51/61 - (83%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SNADPKNMQELTIYVQNLLQNVQDKFQTMSDQIITRIDDMGNRIDDLEKSIADLMNQAGIE 80
            :..|||.||::|:.|:.|||.:|||||.||||||.|||||.:|||||||:|||||.|||:|
  Rat     2 AETDPKTMQDITLVVETLLQQMQDKFQIMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVE 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5446NP_609565.1 HSBP1 28..78 CDD:429139 35/49 (71%)
Hsbp1NP_775142.1 HSBP1 10..60 CDD:429139 35/49 (71%)

Return to query results.
Submit another query.