DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5446 and SPBC16E9.15

DIOPT Version :9

Sequence 1:NP_001260414.1 Gene:CG5446 / 34655 FlyBaseID:FBgn0032429 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_595797.1 Gene:SPBC16E9.15 / 2540124 PomBaseID:SPBC16E9.15 Length:75 Species:Schizosaccharomyces pombe


Alignment Length:61 Identity:17/61 - (27%)
Similarity:36/61 - (59%) Gaps:1/61 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SLNSNA-DPKNMQELTIYVQNLLQNVQDKFQTMSDQIITRIDDMGNRIDDLEKSIADLMNQ 76
            |:..|: :|::...:|.....||:::...|:|:..|...:::.|..|:|.||:|:.:.||:
pombe     4 SVRGNSKNPQSTSAITTLTDKLLEDISGDFETLQKQFSEKLETMSTRLDQLEESMREAMNK 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5446NP_001260414.1 HSBP1 28..78 CDD:399661 14/49 (29%)
SPBC16E9.15NP_595797.1 HSBP1 18..64 CDD:284290 13/45 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103734
Panther 1 1.100 - - LDO PTHR19424
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.