DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5446 and hsb-1

DIOPT Version :9

Sequence 1:NP_001260414.1 Gene:CG5446 / 34655 FlyBaseID:FBgn0032429 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_001379159.1 Gene:hsb-1 / 178208 WormBaseID:WBGene00002002 Length:80 Species:Caenorhabditis elegans


Alignment Length:63 Identity:36/63 - (57%)
Similarity:45/63 - (71%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LNSNADPKNMQELTIYVQNLLQNVQDKFQTMSDQIITRIDDMGNRIDDLEKSIADLMNQAGIE 80
            |::.|| .||.:||..:|.:||..||:||.||||||.|||||..|||||||:|.||:....:|
 Worm    13 LDAPAD-GNMNDLTSLIQGVLQQTQDRFQHMSDQIIRRIDDMTTRIDDLEKNINDLLQSNQVE 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5446NP_001260414.1 HSBP1 28..78 CDD:399661 30/49 (61%)
hsb-1NP_001379159.1 HSBP1 23..72 CDD:399661 30/48 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156549
Domainoid 1 1.000 62 1.000 Domainoid score I6873
eggNOG 1 0.900 - - E1_KOG4117
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I3934
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56480
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto18151
orthoMCL 1 0.900 - - OOG6_103734
Panther 1 1.100 - - LDO PTHR19424
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4388
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.