DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5446 and hsbp1l1

DIOPT Version :9

Sequence 1:NP_001260414.1 Gene:CG5446 / 34655 FlyBaseID:FBgn0032429 Length:86 Species:Drosophila melanogaster
Sequence 2:XP_012820841.1 Gene:hsbp1l1 / 101731304 XenbaseID:XB-GENE-22068517 Length:69 Species:Xenopus tropicalis


Alignment Length:58 Identity:30/58 - (51%)
Similarity:46/58 - (79%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DPKNMQELTIYVQNLLQNVQDKFQTMSDQIITRIDDMGNRIDDLEKSIADLMNQAGIE 80
            |||..|:|:.:..|||:.:|:|||.:|||:..|:::||:.||:|:|.::|||.|||||
 Frog     5 DPKTPQDLSDFADNLLKKLQEKFQVLSDQLTQRMEEMGSNIDELQKDVSDLMTQAGIE 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5446NP_001260414.1 HSBP1 28..78 CDD:399661 23/49 (47%)
hsbp1l1XP_012820841.1 HSBP1 12..60 CDD:284290 22/47 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576489at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.