powered by:
Protein Alignment CG5446 and hsbp1l1
DIOPT Version :9
Sequence 1: | NP_001260414.1 |
Gene: | CG5446 / 34655 |
FlyBaseID: | FBgn0032429 |
Length: | 86 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_012820841.1 |
Gene: | hsbp1l1 / 101731304 |
XenbaseID: | XB-GENE-22068517 |
Length: | 69 |
Species: | Xenopus tropicalis |
Alignment Length: | 58 |
Identity: | 30/58 - (51%) |
Similarity: | 46/58 - (79%) |
Gaps: | 0/58 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 DPKNMQELTIYVQNLLQNVQDKFQTMSDQIITRIDDMGNRIDDLEKSIADLMNQAGIE 80
|||..|:|:.:..|||:.:|:|||.:|||:..|:::||:.||:|:|.::|||.|||||
Frog 5 DPKTPQDLSDFADNLLKKLQEKFQVLSDQLTQRMEEMGSNIDELQKDVSDLMTQAGIE 62
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG5446 | NP_001260414.1 |
HSBP1 |
28..78 |
CDD:399661 |
23/49 (47%) |
hsbp1l1 | XP_012820841.1 |
HSBP1 |
12..60 |
CDD:284290 |
22/47 (47%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1576489at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.