DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6405 and CIBAR2

DIOPT Version :9

Sequence 1:NP_609564.1 Gene:CG6405 / 34654 FlyBaseID:FBgn0032428 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_940893.1 Gene:CIBAR2 / 339145 HGNCID:24781 Length:304 Species:Homo sapiens


Alignment Length:280 Identity:73/280 - (26%)
Similarity:143/280 - (51%) Gaps:10/280 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSFLNTKDDRVKIINERINITERHLMEMCSSFALVTRKMAKYRDSFDELAKSVKSYADDEEINES 71
            ::.:.::|.:|:::...:..||::..:.||..|..|||.|:.||..|:|.|.:..:|:.|  |..
Human     1 MNIVFSRDSQVRVMENTVANTEKYFGQFCSLLAAYTRKTARLRDKADQLVKQLIDFANSE--NPE 63

  Fly    72 LCQGLKSFTNAVTIMGDYMDINVHRLEHKIVNELAQFEQLCKSTRDNLRLAVIARDKEVLRQRQM 136
            |...::.|...:..:.||....|.|||.|:||.|..:....|.||..::.....::.|:.:..::
Human    64 LRATMRGFAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNHEIKQLEKL 128

  Fly   137 LELKSKFSANN---SAADSELFKAKMEVQRTNKEIDDIIGNFEQRKLRDLKQIISDFILIAMKQH 198
            .:|:.|..::.   |.|::.:.:|.::..||..::::.:..|:::||:||::...||:.|.|..|
Human   129 EKLRQKSPSDQQMISQAETRVQRAAVDSSRTTLQLEETVDGFQRQKLKDLQKFFCDFVTIEMVFH 193

  Fly   199 TKALEILSASYYDIGTIDERDDFIEFQKLMKTKEELASRKTALKKGLRSQSMDSLEHEHLVSPLK 263
            .||:|:.|:::..:...|...|.::|:  .|.:.......|.|   |.:.|......:.|.|...
Human   194 AKAVEVYSSAFQTLEKYDLERDLLDFR--AKMQGVYGHYDTRL---LANTSPPPSVLQSLASQGT 253

  Fly   264 RRPKLSRSNRNLTGAGINHG 283
            .:.:|||:|.:......|||
Human   254 LQVQLSRANEDPEHPHANHG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6405NP_609564.1 FAM92 1..222 CDD:284207 58/217 (27%)
CIBAR2NP_940893.1 BAR-like. /evidence=ECO:0000250|UniProtKB:A1XBS5 6..217 58/212 (27%)
BAR_FAM92 6..216 CDD:153282 57/211 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159702
Domainoid 1 1.000 130 1.000 Domainoid score I5207
eggNOG 1 0.900 - - E1_28HP5
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4562
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005047
OrthoInspector 1 1.000 - - otm40927
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21223
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3571
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.850

Return to query results.
Submit another query.