DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6405 and cibar2

DIOPT Version :9

Sequence 1:NP_609564.1 Gene:CG6405 / 34654 FlyBaseID:FBgn0032428 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_004913655.1 Gene:cibar2 / 100486626 XenbaseID:XB-GENE-6044519 Length:293 Species:Xenopus tropicalis


Alignment Length:312 Identity:83/312 - (26%)
Similarity:158/312 - (50%) Gaps:47/312 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSFLNTKDDRVKIINERINITERHLMEMCSSFALVTRKMAKYRDSFDELAKSVKSYADDEEINES 71
            ::.:.::|.:|||:...:...|::..:.||..|..|||.||.||..|||.|::..:|:.|  |..
 Frog     1 MNIVLSRDAQVKIMETTVGNAEKYFGQFCSVLASYTRKTAKLRDKADELVKNLIDFANTE--NPE 63

  Fly    72 LCQGLKSFTNAVTIMGDYMDINVHRLEHKIVNELAQFEQLCKSTRDNLRLAVIARDKEVLRQRQM 136
            |...||:..:.:..:.||....|.|||.|:||.|..:..|.|..|..::.....|::|:....::
 Frog    64 LRTALKNMADELAKIQDYRHAQVERLETKVVNPLKLYGSLIKDKRTEIKKFNSVRNREIKELEKL 128

  Fly   137 LELKSKFSANN---SAADSELFKAKMEVQRTNKEIDDIIGNFEQRKLRDLKQIISDFILIAMKQH 198
            .:|:.:..::.   |.|::.:.||.::..||..:::::|.||:.:|::|:::|.|||:.:.|..|
 Frog   129 EKLRHRAPSDRHVISQAEANVQKASVDAARTTHQLEEVIDNFQLQKVKDIQKIFSDFLTVEMIFH 193

  Fly   199 TKALEILSASYYDIGTIDERDDFIEFQ-KL-MKTKEE---------LASRKTALKKGLRSQSMDS 252
            .::||:.:.::.::...|...|..:|: |: :.|..|         |:|..|     .|:.||. 
 Frog   194 ARSLEVFTNAFQNLQECDLEKDMEDFRTKIHINTGNEDARPMQATNLSSNTT-----WRASSMS- 252

  Fly   253 LEHEHLVSPLKRRPKLSRSNRNLTGAGINHGSKTEPEDETDEQDEEEDDEDE 304
                 :.|.|:|:.::                    |:::.|..|||||.|:
 Frog   253 -----VQSTLQRQQEI--------------------EEDSYEDSEEEDDNDD 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6405NP_609564.1 FAM92 1..222 CDD:284207 62/217 (29%)
cibar2XP_004913655.1 BAR_FAM92 6..216 CDD:153282 61/211 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4801
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4344
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005047
OrthoInspector 1 1.000 - - otm48123
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3571
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.