DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Pkd2 and Loxhd1

DIOPT Version :9

Sequence 1:	NP_609561.2	Gene:	Pkd2 / 34651	FlyBaseID:	FBgn0041195	Length:	924	Species:	Drosophila melanogaster
Sequence 2:	XP_006526497.1	Gene:	Loxhd1 / 240411	MGIID:	1914609	Length:	2278	Species:	Mus musculus

Alignment Length:	99	Identity:	25/99 - (25%)
Similarity:	41/99 - (41%)	Gaps:	21/99 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly   330 EGSEQGSEQGSEQGSEQSPEEVVGEAPEE---APEMDRLQEDFKYNGNPYIDLRGHRRAKR---- 387
            ||.|:......|..||:..||...|..||   .|.|..:...:|::.|.::     .|.|.
Mouse   952 EGGEEEESSSEESSSEEEEEEESEEEEEEEEYGPGMQEVIVQYKFDVNRWL-----ARGKEDNEL 1011

  Fly   388 --------QSGVDGNSEDGSEDVSGNYLKDDSDS 413
                    |||.:.|:.: .:.::||..|..:|:
Mouse  1012 VVELVPAGQSGPEPNTYE-VQVITGNVPKAGTDA 1044

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Pkd2	NP_609561.2	PKD_channel	402..803	CDD:285288	4/12 (33%)
Loxhd1	XP_006526497.1	PLAT_repeat	43..162	CDD:238854
		PLAT_repeat	172..289	CDD:238854
		PLAT_repeat	296..414	CDD:238854
		PLAT_repeat	426..542	CDD:238854
		PLAT_repeat	554..675	CDD:238854
		PLAT_repeat	684..805	CDD:238854
		PLAT	816..>896	CDD:381752
		PLAT_repeat	1026..1146	CDD:238854	5/20 (25%)
		PLAT_repeat	1180..1300	CDD:238854
		PLAT_repeat	1311..1437	CDD:238854
		PLAT_repeat	1465..1585	CDD:238854
		PLAT	1634..1749	CDD:381752
		PLAT_repeat	1763..1880	CDD:238854
		PLAT_repeat	1890..2010	CDD:238854
		PLAT	2023..2124	CDD:381752
		PLAT_repeat	2159..2277	CDD:238854
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3599
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900