DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkd2 and Pkd1l1

DIOPT Version :10

Sequence 1:NP_609561.2 Gene:Pkd2 / 34651 FlyBaseID:FBgn0041195 Length:924 Species:Drosophila melanogaster
Sequence 2:XP_036013024.1 Gene:Pkd1l1 / 171395 MGIID:2156538 Length:2551 Species:Mus musculus


Alignment Length:50 Identity:11/50 - (22%)
Similarity:20/50 - (40%) Gaps:3/50 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 RAGMEGWSWKDVLPYYKKIEHANVKDFDEN--GAHGKSGRVSVEDCPFRS 216
            |.|...:..:....:..|.....||.|.::  |..|....::| .||:.:
Mouse    20 RKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITV-ICPWEA 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkd2NP_609561.2 DUF5585 <29..272 CDD:465521 11/49 (22%)
Polycystin_dom 404..578 CDD:466668
PKD_channel 579..803 CDD:462341
Pkd1l1XP_036013024.1 PCC <167..622 CDD:188093
REJ <835..976 CDD:366875
GPS 1387..1425 CDD:470616
PLAT 1493..1611 CDD:412108
Polycystin_dom 2023..2198 CDD:466668
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.