DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17010 and MAK32

DIOPT Version :9

Sequence 1:NP_609560.2 Gene:CG17010 / 34650 FlyBaseID:FBgn0032424 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_009946.1 Gene:MAK32 / 850381 SGDID:S000000612 Length:363 Species:Saccharomyces cerevisiae


Alignment Length:253 Identity:53/253 - (20%)
Similarity:85/253 - (33%) Gaps:80/253 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KGANQCVAAAKLGASTVLVAKLGKDESGDDYLNHLQQHEVDVTHVQQVENNPTGMSEIAVSENGD 107
            ||.|....:..|.....|..|  |..:.||:::...|..:|..|.                    
Yeast    99 KGLNYYEGSDDLRKFKFLTPK--KQINVDDWISTFGQKIIDEMHA-------------------- 141

  Fly   108 QYKINVAGANVFLTAKDVTRAKKS-----------FQDAKVLLCQL--ETDMNATMCALRQFKGV 159
             :.:..:|:.......|:.|.|.|           |.|    ||..  :.|:.:.|         
Yeast   142 -FHLLCSGSRCLDIINDLLRVKSSKGTKPIVIWEPFPD----LCDFDHQNDIKSVM--------- 192

  Fly   160 SLLHMSPMRKDIPNAMIGLPTILVANQEAAANL--------TDMEEVLTPDQARKAAETLIAKGA 216
                   .|.|:       ..||..|.|.::.|        |.:||.|.  .|.:..:.:...  
Yeast   193 -------QRNDV-------TVILSPNAEESSRLFGLSSKEPTSLEECLA--LAHRFDDFMDEN-- 239

  Fly   217 KSVIITMGEQGAVYMSKKSKDMCT--HVPA---SDVPHLADPSGAGDAFMGSLAYHIA 269
            ...|:..|..|::.:|:|.|:..|  |.||   .....:.||:|.|::|:|..|...|
Yeast   240 NMCILRCGALGSISVSEKFKNGRTYDHFPAYHFKTQSKVLDPTGGGNSFLGGFAVSYA 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17010NP_609560.2 ribokinase 6..301 CDD:238579 53/253 (21%)
MAK32NP_009946.1 MAK32 13..344 CDD:238918 53/253 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.