DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17010 and CG7335

DIOPT Version :9

Sequence 1:NP_609560.2 Gene:CG17010 / 34650 FlyBaseID:FBgn0032424 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_649180.1 Gene:CG7335 / 40203 FlyBaseID:FBgn0036941 Length:372 Species:Drosophila melanogaster


Alignment Length:159 Identity:43/159 - (27%)
Similarity:68/159 - (42%) Gaps:11/159 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLDVVVFGTANIEYITYVPELPK-PGELVAGTYMETCFGGKGANQCVAAAKLGASTVLVAKLGKD 67
            |..|:..|:..::.||.| :||. ||::...|......||..||.|....:||.....:..|.:.
  Fly    30 KRHVLAVGSCTLDMITIV-DLPLFPGQVQRTTEGSWRRGGPAANICTVWRRLGLECEFLGVLSRV 93

  Fly    68 ESGDDYLNHLQQHEVDVTHVQQVENNPTGMSEIAVSENGD-QYKINVAGANVFLTAKDVTRA--- 128
            .:.:..||..|...:|::|.....:.|...| |.|..|.| :..:..|.||..||.:....|   
  Fly    94 RAFESLLNGFQSQGIDISHCPLTNHRPAHRS-IIVQRNVDTRTMLEFANANQELTYQQFVGAVDY 157

  Fly   129 -KKSFQDAKVLLCQLETDMNATMCALRQF 156
             |.|:...:   |:...:|...:.|:.||
  Fly   158 QKYSWIHFE---CRNPVEMLRMVLAVIQF 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17010NP_609560.2 ribokinase 6..301 CDD:238579 42/157 (27%)
CG7335NP_649180.1 Ketohexokinase 32..357 CDD:238914 42/157 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456470
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.