DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17010 and adka

DIOPT Version :9

Sequence 1:NP_609560.2 Gene:CG17010 / 34650 FlyBaseID:FBgn0032424 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_997956.1 Gene:adka / 368220 ZFINID:ZDB-GENE-030425-3 Length:359 Species:Danio rerio


Alignment Length:270 Identity:70/270 - (25%)
Similarity:109/270 - (40%) Gaps:48/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LGKDESGDDYLNHLQQHEVDVTHVQQVENNPTGMSEIAVSENGDQYKINVAGANVFLTAK--DVT 126
            :|||:.|.......::..||..:.:|.| .|||.....::.:......|:|.||.:...|  |:.
Zfish   104 IGKDKFGKILKEKAEEAHVDAHYYEQSE-EPTGSCAACITGDNRSLVANLAAANCYKKEKHLDLE 167

  Fly   127 RAKKSFQDAKV-------LLCQLETDMNATMCALRQFKGVSLLHMS----------PMRKDIPNA 174
            ...|..:.|:|       |...||:.:.....|....| :..|::|          .:.|.:|..
Zfish   168 ENWKLVEKAQVYYIAGFFLTVSLESILKVAKHASENNK-IFCLNLSAPFICEFFKEALMKVMPYV 231

  Fly   175 MIGLPTILVANQ-EAAA-------NLTDMEEVLTPDQARKAAETLIAKGAKS---VIITMGEQGA 228
                 .||..|: ||||       ...|:||:      .|.|::|..:..|.   |:.|.|::|.
Zfish   232 -----DILFGNETEAAAFAREQGFETEDIEEI------AKKAQSLPKENKKRQRIVVFTQGKEGT 285

  Fly   229 VYMSKKSKDMCTHVPASDVPHLADPSGAGDAFMGSLAYHIARFPKLSTEHHISAAHSCAAYSMGR 293
            | |:|..|.....|...|...:.|.:||||||:|.....:.:  ..:.|..|.|.|..|...:..
Zfish   286 V-MAKGDKVETFPVLEIDQSEIVDTNGAGDAFVGGFLSQLVQ--DKTFEQCIRAGHYAANVIIRH 347

  Fly   294 RGTQPSFPGK 303
            .|.  :||.|
Zfish   348 AGC--TFPEK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17010NP_609560.2 ribokinase 6..301 CDD:238579 67/266 (25%)
adkaNP_997956.1 PTZ00247 23..358 CDD:240328 70/270 (26%)
ribokinase_pfkB_like 26..358 CDD:294126 70/270 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.