DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17010 and CG2794

DIOPT Version :9

Sequence 1:NP_609560.2 Gene:CG17010 / 34650 FlyBaseID:FBgn0032424 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_608533.1 Gene:CG2794 / 33233 FlyBaseID:FBgn0031265 Length:700 Species:Drosophila melanogaster


Alignment Length:357 Identity:73/357 - (20%)
Similarity:139/357 - (38%) Gaps:73/357 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VVFGTANIEYITYVPELPKPGELVAGTY---METCFGGKGANQCVAAAKLGASTVLVAKLGKDES 69
            :|.|.:.::....|.:..:..:|...||   .:...||.|.|......||.....|::.:|.|:.
  Fly   347 LVVGASILDLSFKVDDQKRDMKLDGATYSAVAKQAAGGVGRNIAEGIYKLYGDVNLISAVGNDQM 411

  Fly    70 GDDYLNHLQQHEVDVTHVQQVENNPTGMSEIAVSENGDQYKINVAGANVF--LTAKDVTRAKKSF 132
            |...|..:.:.......|  .:|:.|.:..:...:.|| .|:.:....:.  :||:.:....:.|
  Fly   412 GQTLLQMMPKALKRGLIV--ADNHNTSLCSLIFDKFGD-CKLILGNMEIHQSITAETLQAHHQLF 473

  Fly   133 QDAKVLLCQLETDMNATMCALRQFKGVSLLHMSPMRKDIPNAMIGLPT-ILVANQ------EAAA 190
            ::|.:::    .|.|.:..|:     .|:|..:.:.| ||  :...|| :.:|.:      |...
  Fly   474 REAPLII----MDSNISEQAM-----ASILQQAQINK-IP--VFFEPTDMFIAGKPFKLLPELTK 526

  Fly   191 NL----TDMEEVLTPDQA-----------RKAAETLIAKGAKS-----------VIITMGEQGAV 229
            |:    .:|:|:.|..:|           .|..:|.:.:.|||           :|.|:.:.|.:
  Fly   527 NIRLIKPNMQELKTITEAITGETVKWNPETKQPQTELVQQAKSLIKKIDSHFNCIIATLSDHGVL 591

  Fly   230 Y---------------MSKKSKDMCTH-VPASDVPHLADPSGAGDAFMGSLAYHIARFPKLSTEH 278
            .               :||.:....|. .||..|.::.:.|||||:|.......:.|  ..|.:.
  Fly   592 LSYRGDAENDARLLLDVSKPTPPHSTRFYPAPMVHNIVNVSGAGDSFCAGFITALLR--GRSLDE 654

  Fly   279 HISAAHSCAAYSMGRRGTQPS--FPGKESAKS 308
            .|:.....|..::......|:  |..:||.:|
  Fly   655 CIAGGFVAAERALQSESAVPATYFSNQESFES 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17010NP_609560.2 ribokinase 6..301 CDD:238579 69/348 (20%)
CG2794NP_608533.1 Indigoidine_A 34..324 CDD:282130
YeiC_kinase_like 345..669 CDD:238916 68/338 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456450
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.