DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17010 and Adk

DIOPT Version :9

Sequence 1:NP_609560.2 Gene:CG17010 / 34650 FlyBaseID:FBgn0032424 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_006251693.1 Gene:Adk / 25368 RGDID:2046 Length:403 Species:Rattus norvegicus


Alignment Length:315 Identity:69/315 - (21%)
Similarity:114/315 - (36%) Gaps:64/315 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ELVAGTYMETCFGGKGANQCVAAAKL----GASTVLVAKLGKDESGDDYLNHLQQHEVDVTHVQQ 89
            |||....:|...||...|....|..:    ..:......:|.|:.|:...:......||..:.:|
  Rat   109 ELVKKFKVEYHAGGSTQNSMKVAQWMIQEPHRAATFFGCIGIDKFGEILKSKAADAHVDAHYYEQ 173

  Fly    90 VENNPTGMSEIAVSENGDQYKINVAGANVFLTAKD---------VTRAKKSF---------QDAK 136
            .| .|||.....::........|:|.||.:...|.         |.:|:..:         .::.
  Rat   174 NE-QPTGTCAACITGGNRSLVANLAAANCYKKEKHLDLENNWMLVEKARVYYIAGFFLTVSPESV 237

  Fly   137 VLLCQLETDMNATMCA------LRQFKGVSLLHMSPMRKDIPNAMIGLPTILVANQEAAANLT-- 193
            :.:.:...:.|.|...      :.||...:|:.:.|           ...||..|:..||...  
  Rat   238 LKVARYAAENNRTFTLNLSAPFISQFFKEALMEVMP-----------YVDILFGNETEAATFARE 291

  Fly   194 ------DMEEVLTPDQARK--AAETLIAKGAKSVIITMGEQGAVYMSKKSKDMCTHVPASD--VP 248
                  |::|:     |||  |...:.:|..::||.|.|....:..:  ..|: |..|..|  ..
  Rat   292 QGFETKDIKEI-----ARKTQALPKVNSKRQRTVIFTQGRDDTIVAT--GNDV-TAFPVLDQNQE 348

  Fly   249 HLADPSGAGDAFMGSLAYHIARFPKLSTEHHISAAHSCAAYSMGRRGTQPSFPGK 303
            .:.|.:||||||:|.....:.....|:  ..|.|.|..|:..:.|.|.  :||.|
  Rat   349 EIVDTNGAGDAFVGGFLSQLVSNKPLT--ECIRAGHYAASVIIRRTGC--TFPEK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17010NP_609560.2 ribokinase 6..301 CDD:238579 66/311 (21%)
AdkXP_006251693.1 PTZ00247 60..402 CDD:240328 69/315 (22%)
ribokinase_pfkB_like 70..402 CDD:294126 69/315 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.