DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17010 and Adk

DIOPT Version :9

Sequence 1:NP_609560.2 Gene:CG17010 / 34650 FlyBaseID:FBgn0032424 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_598840.1 Gene:Adk / 11534 MGIID:87930 Length:361 Species:Mus musculus


Alignment Length:310 Identity:71/310 - (22%)
Similarity:110/310 - (35%) Gaps:54/310 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ELVAGTYMETCFGGKGANQCVAAAKL----GASTVLVAKLGKDESGDDYLNHLQQHEVDVTHVQQ 89
            |||....:|...||...|....|..|    ..:......:|.|:.|:..........||..:.:|
Mouse    67 ELVKKFKVEYHAGGSTQNSMKVAQWLIQEPHKAATFFGCIGIDKFGEILKRKAADAHVDAHYYEQ 131

  Fly    90 VENNPTGMSEIAVSENGDQYKINVAGANVFLTAK--DVTRAKKSFQDAKV-------LLCQLET- 144
            .| .|||.....::........|:|.||.:...|  |:.|.....:.|:|       |....|: 
Mouse   132 NE-QPTGTCAACITGGNRSLVANLAAANCYKKEKHLDLERNWVLVEKARVYYIAGFFLTVSPESV 195

  Fly   145 --------------DMNATMCALRQFKGVSLLHMSPMRKDIPNAMIGLPTILVANQEAAANLTDM 195
                          .:|.:...:.||...:|:.:.|           ...||..|:..||.....
Mouse   196 LKVARYAAENNRVFTLNLSAPFISQFFKEALMDVMP-----------YVDILFGNETEAATFARE 249

  Fly   196 EEVLTPD--QARKAAETL---IAKGAKSVIITMGEQGAVYMSKKSKDMCTHVPASD--VPHLADP 253
            :...|.|  :..|.|:.|   .:|..::||.|.|....:..::..   .|..|..|  ...:.|.
Mouse   250 QGFETKDIKEIAKKAQALPKVNSKRQRTVIFTQGRDDTIVAAEND---VTAFPVLDQNQEEIIDT 311

  Fly   254 SGAGDAFMGSLAYHIARFPKLSTEHHISAAHSCAAYSMGRRGTQPSFPGK 303
            :||||||:|.....:.....|:  ..|.|.|..|:..:.|.|.  :||.|
Mouse   312 NGAGDAFVGGFLSQLVSDKPLT--ECIRAGHYAASVIIRRTGC--TFPEK 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17010NP_609560.2 ribokinase 6..301 CDD:238579 68/306 (22%)
AdkNP_598840.1 Nuclear localization signal. /evidence=ECO:0000250 7..15
ribokinase_pfkB_like 28..360 CDD:320807 71/310 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.