DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bru1 and CELF4

DIOPT Version :9

Sequence 1:NP_001260403.1 Gene:bru1 / 34648 FlyBaseID:FBgn0000114 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_001340669.1 Gene:CELF4 / 56853 HGNCID:14015 Length:545 Species:Homo sapiens


Alignment Length:586 Identity:197/586 - (33%)
Similarity:270/586 - (46%) Gaps:168/586 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 SNGTSSNNSLNVGNNNSNPSLGGSNSNALVSVGSNGIMSAAGLVNNNNNPCSANRNVVAMVDDDA 335
            :||.:.|.||:.....|:|             ||.|.|:  ||.::..||     :.:.|.|.||
Human     9 ANGQADNASLSTNGLGSSP-------------GSAGHMN--GLSHSPGNP-----STIPMKDHDA 53

  Fly   336 CFRLDTDATVTYGEKEPDPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGC 400
                                 ||:|:||:|:::||..|:.:|||:|.::.:.||:|:.||:.|||
Human    54 ---------------------IKLFIGQIPRNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGC 97

  Fly   401 CFVTFYTRHAALKAQDALHNVKTLNGMYHPIQMKPADSENR-----------NERKLFVGMLNKK 454
            .|:|:..|.:|||||.|||..|||.||..|||:||||||:|           .:||||||||||:
Human    98 AFLTYCERESALKAQSALHEQKTLPGMNRPIQVKPADSESRGGSSCLRQPPSQDRKLFVGMLNKQ 162

  Fly   455 LNENDVRKLFEVHGAIEECTVLRDQNGQSKGCAFVTFATKHAAISAIKVTLSQNKIMEGCTSPLV 519
            .:|:|||:|||..|.|||||:||..:|.|||||||.::: ||...|....|..::.|.|.:|.||
Human   163 QSEDDVRRLFEAFGNIEECTILRGPDGNSKGCAFVKYSS-HAEAQAAINALHGSQTMPGASSSLV 226

  Fly   520 VKFADTQKEKEQKKIQQIQANLWNLASNINIPLGQTATSVTTPILPNPPQQPSPVLGADAITPAS 584
            ||||||.||:..:::||:              .||..       :.||...|....||.|     
Human   227 VKFADTDKERTMRRMQQM--------------AGQMG-------MFNPMAIPFGAYGAYA----- 265

  Fly   585 IQLLQQLQAVGLQHQLLQALTGLGAQQSSSATDTSAVAAAGLLTPMTVQNLAAIAAMTQPSLSNA 649
             |.|.|.||..:                      ::||..|.|.||.....|.:..|...:::..
Human   266 -QALMQQQAALM----------------------ASVAQGGYLNPMAAFAAAQMQQMAALNMNGL 307

  Fly   650 AAAAAAATSPGSAQLTNTAALLWSDPNPMA---------------SAYMSTAAGLPQFGSASALS 699
            |||....||.||.....||..:.|.|:|:.               :|....|.|:..:.:.|..:
Human   308 AAAPMTPTSGGSTPPGITAPAVPSIPSPIGVNGFTGLPPQANGQPAAEAVFANGIHPYPAQSPTA 372

  Fly   700 TSPLASV-------ALSAAAAAAAG---------------KQIEGPEGCNLFIYHLPQEFTDTDL 742
            ..||...       |..||..||.|               :|.|||||||||||||||||.|.:|
Human   373 ADPLQQAYAGVQQYAGPAAYPAAYGQISQAFPQPPPMIPQQQREGPEGCNLFIYHLPQEFGDAEL 437

  Fly   743 ASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAMNGFQV----GTKRLKVQLKK 803
            ...|||||.                        :|..|:....:..|.|.    .|:||: :|::
Human   438 MQMFLPFGR------------------------HPVPARCQAPSCQGGQCPINSSTRRLR-ELRQ 477

  Fly   804 P 804
            |
Human   478 P 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bru1NP_001260403.1 RRM1_CELF1_2_Bruno 356..437 CDD:241075 42/80 (53%)
ELAV_HUD_SF 359..808 CDD:273741 176/498 (35%)
RRM2_Bruno_like 443..524 CDD:241080 45/80 (56%)
RRM3_Bruno_like 722..800 CDD:241084 30/81 (37%)
CELF4NP_001340669.1 Sufficient for RNA-binding and MSE-dependent splicing activity 1..298 138/379 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..39 9/35 (26%)
RRM1_CELF3_4_5_6 49..135 CDD:241076 46/106 (43%)
PABP-1234 <56..378 CDD:130689 136/371 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..149 13/27 (48%)
RRM2_CELF3_4_5_6 151..231 CDD:241079 45/80 (56%)
Necessary for TNNT2 exon 5 inclusion 239..258 6/39 (15%)
RRM_SF 417..>445 CDD:388407 21/27 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146322
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0144
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1209165at2759
OrthoFinder 1 1.000 - - FOG0000286
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X208
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.