DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bru1 and Pof

DIOPT Version :9

Sequence 1:NP_001260403.1 Gene:bru1 / 34648 FlyBaseID:FBgn0000114 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_001246498.1 Gene:Pof / 37947 FlyBaseID:FBgn0035047 Length:495 Species:Drosophila melanogaster


Alignment Length:250 Identity:54/250 - (21%)
Similarity:94/250 - (37%) Gaps:51/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   581 TPASIQLLQQLQAVGLQHQLLQALTGLGAQQSSSATDTSAVAAAGLLTPMTVQNLAAIAAMTQPS 645
            |||..|||....:|.|.:.     ..|....|....||:.::...|........|.|:|  .:..
  Fly    63 TPAGSQLLPWKTSVDLDND-----AELEKPTSDKKPDTAKLSRRELAKMRREHTLRALA--LERE 120

  Fly   646 LSNAAAAAAAATSPGSAQLTNTAALLWSDPNPMASAYMSTAAGLPQ--FGSASALSTSP-LASVA 707
            |:|         .||  |...:..||...|:|..:|.|  .|||.:  ......:|.:| ...|.
  Fly   121 LTN---------KPG--QTPASEVLLVRFPDPEITAPM--LAGLSKDIRDVVLPISVAPRYCLVH 172

  Fly   708 LSAAAAAAA------------------------GKQIEGPEGCNLFIYHLPQEFTDTDLASTFLP 748
            |.|.|...|                        .:|.|..:.|:|::.::|...|.:.:.:.   
  Fly   173 LKAGADVEATICDINRVRFGTGHLRAELKPFSDEEQAEFIDPCSLYVGNIPFNMTTSAIKAY--- 234

  Fly   749 FGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAMNGFQVGTKRLKVQLKK 803
            |.|.:...:.:.|:...:: :.||.:.:||....|.|.:....:.::.|.|:.::
  Fly   235 FANAMRVDIGVLKREKRAR-YAFVRYASPDQTMEAFKELVDSPLNSRTLTVRYRR 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bru1NP_001260403.1 RRM1_CELF1_2_Bruno 356..437 CDD:241075
ELAV_HUD_SF 359..808 CDD:273741 54/249 (22%)
RRM2_Bruno_like 443..524 CDD:241080
RRM3_Bruno_like 722..800 CDD:241084 14/77 (18%)
PofNP_001246498.1 RRM <201..>292 CDD:223796 17/91 (19%)
RRM_SF 217..285 CDD:240668 13/71 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447737
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.