DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bru1 and CG4612

DIOPT Version :9

Sequence 1:NP_001260403.1 Gene:bru1 / 34648 FlyBaseID:FBgn0000114 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster


Alignment Length:275 Identity:61/275 - (22%)
Similarity:120/275 - (43%) Gaps:56/275 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 GTSSNNSLNVGNNNSNPSLGGSNSNALVSVGSNGIMSAAGLVNNNNNPCSANRNVVAMVDDDACF 337
            |...:|||..|:.::      |:.:|.|.||..|...|:|....:....|               
  Fly    66 GRHGHNSLGSGHTST------SSHSANVGVGVGGGALASGSTGGSGGNSS--------------- 109

  Fly   338 RLDTDATVTYGEKEPDPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCF 402
                            ||:.|:::..:.:|:|...:.:.|..:|.:.:.||.:|: .|.|:|..|
  Fly   110 ----------------PDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGF 157

  Fly   403 VTFYTRHAALKAQDALHNVKTLNGMYHPIQMKPADSENRNE----RKLFVGMLNKKLNENDVRKL 463
            |.|.:..||..|.:.::.:...|...|.::..|.....:.:    :.|:|..|:::..|..:|::
  Fly   158 VHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREM 222

  Fly   464 FEVHGAIEECTVLRDQNGQSKGCAFVTFATKHAAISAI----KVTLSQNKIMEGCTSPLVVKFAD 524
            ||.:|.|....::.|:.|:|:...||.:....:|::|:    ...|..||.       |.|..|.
  Fly   223 FEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKF-------LYVARAL 280

  Fly   525 TQKEKEQ---KKIQQ 536
            ::.|::|   :|:::
  Fly   281 SKAERQQEINRKLEE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bru1NP_001260403.1 RRM1_CELF1_2_Bruno 356..437 CDD:241075 20/80 (25%)
ELAV_HUD_SF 359..808 CDD:273741 44/189 (23%)
RRM2_Bruno_like 443..524 CDD:241080 21/88 (24%)
RRM3_Bruno_like 722..800 CDD:241084
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 17/70 (24%)
RRM3_I_PABPs 202..282 CDD:240826 22/86 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.