DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bru1 and Spx

DIOPT Version :9

Sequence 1:NP_001260403.1 Gene:bru1 / 34648 FlyBaseID:FBgn0000114 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_511058.1 Gene:Spx / 31558 FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster


Alignment Length:260 Identity:61/260 - (23%)
Similarity:119/260 - (45%) Gaps:47/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 DATVTYGEKEPDPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFY 406
            |||:              :.|.:...:.|:.|.|:|.:.|.|.::::.:|:.|.:.:|..||.| 
  Fly    12 DATI--------------YAGGLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEF- 61

  Fly   407 TRHAALKAQDALHNVKTLN--GMY-HPIQMKPADSENRN---ERKLFVGMLNKKLNENDVRKLFE 465
                 |..:||.:.:|.:|  .:| .||::..|.:..:|   ...:|:|.|:.:::|..:...|.
  Fly    62 -----LSEEDADYGIKIMNMIKLYGKPIRVNKASAHQKNLDVGANIFIGNLDVEVDEKLLYDTFS 121

  Fly   466 VHGAI-EECTVLRD-QNGQSKGCAFVTFATKHAAISAIKVTLSQNKIMEG---CTSPLVVKFA-- 523
            ..|.| :...::|| :.|:||..||:.||:..|:.:|:..       |.|   |..|:.|.:|  
  Fly   122 AFGVILQTPKIMRDPETGKSKSFAFINFASFEASDAAMDA-------MNGQYLCNRPISVSYAFK 179

  Fly   524 -DTQKEKEQKKIQQIQANLWNLASNINIPLGQTATSVTTPILPN-----PPQQPSPVLGADAITP 582
             |.:.|:.....:::.| ..|.:::.:.|....|.:....::|.     |.|.|..::....:.|
  Fly   180 KDHKGERHGSAAERLLA-AQNPSTHADRPHQLFADAPVQTMMPQMPGQIPAQMPGQMMPPPMMAP 243

  Fly   583  582
              Fly   244  243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bru1NP_001260403.1 RRM1_CELF1_2_Bruno 356..437 CDD:241075 21/83 (25%)
ELAV_HUD_SF 359..808 CDD:273741 58/243 (24%)
RRM2_Bruno_like 443..524 CDD:241080 24/88 (27%)
RRM3_Bruno_like 722..800 CDD:241084
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780 21/92 (23%)
RRM2_SF3B4 99..181 CDD:240781 24/88 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.