DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bru1 and EEED8.12

DIOPT Version :9

Sequence 1:NP_001260403.1 Gene:bru1 / 34648 FlyBaseID:FBgn0000114 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_495021.1 Gene:EEED8.12 / 173922 WormBaseID:WBGene00017140 Length:197 Species:Caenorhabditis elegans


Alignment Length:95 Identity:22/95 - (23%)
Similarity:45/95 - (47%) Gaps:1/95 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   709 SAAAAAAAGKQIEGPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVS 773
            |||......::.:..:..::||.::....|..::...|...|:::...:..||.|...|.|.::.
 Worm    44 SAAYVPPTEEEQKAIDAKSVFIGNVDFNSTIEEVEEHFKGCGHIVRTTIPKDKFTKKQKNFAYIE 108

  Fly   774 FDNPDSAQVAIKAMNGFQVGTKRLKVQLKK 803
            ||:..|.:.|: .|||....::.:.|..|:
 Worm   109 FDDSSSIENAL-VMNGSLFRSRPIVVTAKR 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bru1NP_001260403.1 RRM1_CELF1_2_Bruno 356..437 CDD:241075
ELAV_HUD_SF 359..808 CDD:273741 22/95 (23%)
RRM2_Bruno_like 443..524 CDD:241080
RRM3_Bruno_like 722..800 CDD:241084 17/77 (22%)
EEED8.12NP_495021.1 RRM <11..>133 CDD:223796 20/89 (22%)
RRM_II_PABPs 62..134 CDD:240752 17/72 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158900
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.