DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bru1 and EEED8.4

DIOPT Version :10

Sequence 1:NP_723737.1 Gene:bru1 / 34648 FlyBaseID:FBgn0000114 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_495022.2 Gene:EEED8.4 / 173921 WormBaseID:WBGene00017135 Length:191 Species:Caenorhabditis elegans


Alignment Length:95 Identity:22/95 - (23%)
Similarity:44/95 - (46%) Gaps:1/95 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   709 SAAAAAAAGKQIEGPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVS 773
            |||......::.:..:..::||.::....|..::...|...|.::...:..||.|...|.|.::.
 Worm    38 SAAYVPPTEEEQKAIDAKSVFIGNVDFNSTIEEIEEHFKGCGQIVKTTIPKDKFTKKQKNFAYIE 102

  Fly   774 FDNPDSAQVAIKAMNGFQVGTKRLKVQLKK 803
            ||:..|.:.|: .|||....::.:.|..|:
 Worm   103 FDDSSSIENAL-VMNGSLFRSRPIVVTAKR 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bru1NP_723737.1 RRM1_CELF1_2_Bruno 356..437 CDD:410040
SF-CC1 <435..789 CDD:273721 18/79 (23%)
RRM_SF 443..524 CDD:473069
RRM3_Bruno_like 722..800 CDD:241084 17/77 (22%)
EEED8.4NP_495022.2 RRM_II_PABPs 56..128 CDD:409747 17/72 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.