Sequence 1: | NP_001260408.1 | Gene: | atilla / 34647 | FlyBaseID: | FBgn0032422 | Length: | 143 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_648500.1 | Gene: | crim / 39321 | FlyBaseID: | FBgn0036198 | Length: | 158 | Species: | Drosophila melanogaster |
Alignment Length: | 166 | Identity: | 39/166 - (23%) |
---|---|---|---|
Similarity: | 62/166 - (37%) | Gaps: | 52/166 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 VIFVLLIAVCTMHSASAIKCYQCKSLTDPNCAKDKIDSASNIRAVDC--DSVPKPNTMEQLQPVT 67
Fly 68 RCNKVVTSDRAGTIVSRDC----------------------HFESIGQ------KDNECTVTHSR 104
Fly 105 QVESCYTCKGDLCN-ASGAGRFVAVSATALLAILAL 139 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR33562 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |