DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atilla and CG9338

DIOPT Version :9

Sequence 1:NP_001260408.1 Gene:atilla / 34647 FlyBaseID:FBgn0032422 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001260646.1 Gene:CG9338 / 35357 FlyBaseID:FBgn0032899 Length:147 Species:Drosophila melanogaster


Alignment Length:145 Identity:45/145 - (31%)
Similarity:62/145 - (42%) Gaps:18/145 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKQVIFVLLIAV-----CTMHSASAIKCYQCKSLTDPNCAKDKIDSASNIRAVDCDSVPKPNTM 60
            |:..|..:|.:.|     ||.:   |||||||.|||:..|.|| |.|.|:: .:||..:..|..:
  Fly     1 MVSSVKMILALTVLATVACTGY---AIKCYQCDSLTNSECGKD-IKSDSSL-VLDCTKMAPPRFL 60

  Fly    61 EQLQPV---TRCNKVVTSDRAGTIVSRDCHFESIGQKDNECTVTHSRQVE---SCYTCKGDLCNA 119
            :...||   |.|.|..........:.|.|:|.:|......|....|..:.   ||..|..|.|| 
  Fly    61 QNFFPVRNATGCMKQTIDIPGNPQIVRSCYFGNIADTKVGCQTDPSLTINKLLSCEVCTEDECN- 124

  Fly   120 SGAGRFVAVSATALL 134
             |......::...||
  Fly   125 -GTSSLAPIAGVILL 138



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012691
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.