DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atilla and twit

DIOPT Version :9

Sequence 1:NP_001260408.1 Gene:atilla / 34647 FlyBaseID:FBgn0032422 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_610067.1 Gene:twit / 35353 FlyBaseID:FBgn0032895 Length:166 Species:Drosophila melanogaster


Alignment Length:152 Identity:34/152 - (22%)
Similarity:57/152 - (37%) Gaps:22/152 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IFVL-----LIAVCTMHSASAIKCYQCKSLTDPNCAKDKIDSASNIRAVDCDSVPKPN------- 58
            :|:|     :.|:...|....::|:.|.|  |...|:|..|.......:..|.:.:.|       
  Fly    13 LFLLANAWHITAINEQHQKHHLQCWHCSS--DTIGAEDFCDVTFQEDNIPTDLIKERNINLLRSC 75

  Fly    59 --TMEQLQPVTRCNKVVTSDRAGTIVSRDCHFESIGQKDNECTVT----HSRQVESCYTCKGDLC 117
              |:........|.|.|..:....|..|.|::.:.......|.:|    :.|:: .|..|..|.|
  Fly    76 NGTINSDHERAVCRKTVEENNGKLITKRFCYYTNKSDPVELCNITSPEKNVRRI-FCEDCLTDRC 139

  Fly   118 NASGAGRFVAVSATALLAILAL 139
            |.:.||..: :....||.|..|
  Fly   140 NGALAGASI-LEMLLLLPIAGL 160



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.