DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atilla and bou

DIOPT Version :9

Sequence 1:NP_001260408.1 Gene:atilla / 34647 FlyBaseID:FBgn0032422 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_572373.1 Gene:bou / 31644 FlyBaseID:FBgn0261284 Length:149 Species:Drosophila melanogaster


Alignment Length:148 Identity:36/148 - (24%)
Similarity:51/148 - (34%) Gaps:29/148 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKQVIFVLLIAVCTMHSASAIKCYQCKSLTDPNCAKDKIDSASNIRAVDCD------SVP--KPN 58
            |..:..|:|:....|...|.|:||.|             |::.......|.      .:|  :|.
  Fly    12 LSSLALVVLLMSLQMVMVSGIECYVC-------------DTSDTEHPFQCGEWFERYDIPDIQPQ 63

  Fly    59 TMEQLQPVTRCNKVVTSDRAGTIVSRDCHFESIGQKDNECTVTHSR----QVESC-YTCKGDLCN 118
            ....:.....|.|.|.....|....|.|..:.:|   |.|....::    ...|| |||..|.||
  Fly    64 NCSSVHGAQFCVKHVGRFEGGIGAKRFCSSKDMG---NYCDYVRNKGDRMDYRSCIYTCDTDGCN 125

  Fly   119 ASGAGRFVAVSATALLAI 136
            |:|........|.|||.:
  Fly   126 AAGRLELEWGVAAALLTL 143



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33562
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.