Sequence 1: | NP_001260408.1 | Gene: | atilla / 34647 | FlyBaseID: | FBgn0032422 | Length: | 143 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_499966.1 | Gene: | K11H12.7 / 176893 | WormBaseID: | WBGene00019663 | Length: | 127 | Species: | Caenorhabditis elegans |
Alignment Length: | 141 | Identity: | 35/141 - (24%) |
---|---|---|---|
Similarity: | 64/141 - (45%) | Gaps: | 26/141 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 VIFVLLIAVCTMHSASAIKCYQCKSLTDPNCAK--DKIDSASNIRAVDCDSVPKPNTMEQLQPV- 66
Fly 67 TRCNKVVTSDRAGTIVSRDCHF--ESIGQKDNECTVTHSRQVESCYTCKGDLCN-ASGAGRFVAV 128
Fly 129 SATALLAILAL 139 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |