DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crok and twit

DIOPT Version :10

Sequence 1:NP_609557.1 Gene:crok / 34646 FlyBaseID:FBgn0032421 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_610067.1 Gene:twit / 35353 FlyBaseID:FBgn0032895 Length:166 Species:Drosophila melanogaster


Alignment Length:144 Identity:33/144 - (22%)
Similarity:53/144 - (36%) Gaps:30/144 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IKCWDCRSDN---DPKCGDPFDNSTLAITDCQQAPELEHLKGVRPT--------MCRKIRQKVHG 77
            ::||.|.||.   :..|...|....:. ||..:...:..|:....|        :|||..::.:|
  Fly    34 LQCWHCSSDTIGAEDFCDVTFQEDNIP-TDLIKERNINLLRSCNGTINSDHERAVCRKTVEENNG 97

  Fly    78 EWRYFRSCAYMGEPGIEGDERFCLMRTGSYNIFMEFCTCNSKDGCNSAGIHRLGLMGVLTGT--- 139
            :....|.|.|..:   ......|.:.:...|:...||.....|.||          |.|.|.   
  Fly    98 KLITKRFCYYTNK---SDPVELCNITSPEKNVRRIFCEDCLTDRCN----------GALAGASIL 149

  Fly   140 --LLSVIVAHLLRQ 151
              ||.:.:|.|::|
  Fly   150 EMLLLLPIAGLIQQ 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crokNP_609557.1 TFP_LU_ECD_Crok 22..125 CDD:467121 25/111 (23%)
twitNP_610067.1 TFP_LU_ECD_Twit 33..142 CDD:467122 25/121 (21%)

Return to query results.
Submit another query.