DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6583 and crok

DIOPT Version :10

Sequence 1:NP_609556.2 Gene:CG6583 / 34645 FlyBaseID:FBgn0032420 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_609557.1 Gene:crok / 34646 FlyBaseID:FBgn0032421 Length:151 Species:Drosophila melanogaster


Alignment Length:216 Identity:42/216 - (19%)
Similarity:73/216 - (33%) Gaps:74/216 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 KDLLSANVKIFKVQGEALDKYAKKDVKVLV---VGNPA-----------NTN--------ALVCS 142
            ::|:|      |.|.:.||.:|:..|...|   :|.|:           :|:        |..||
  Fly   651 QELMS------KTQNDFLDHFARLGVYTKVQALMGEPSFDGSDNNDVIKSTSDDAKSAAAAAACS 709

  Fly   143 H--------YAPSIPKANFTAMTRLDQNRAQAQIAGRLGVGITKVKNVI---------------- 183
            .        ..|..|     .:|......|.|.:|      :...|.::                
  Fly   710 STDASGVVTVTPGAP-----TVTTASGGTASAAVA------VEDAKEILHGKAYHWHDWSICRGR 763

  Fly   184 ----IWGNHSATQVPDARNASVE--VDGATKTV-----PEAVADDEFLKQQFLETVQKRGAAVIA 237
                :|.:.:|.::.:..|....  :||...|:     ||..:|....:.:|||.:|:..|||..
  Fly   764 DCLYVWSDSAALELSNGSNGWFRFILDGKLATMYSSGSPENGSDSTENRGEFLEKLQRARAAVRQ 828

  Fly   238 ARKMSSAMSAAKAASDHMRDW 258
            .......:||...|...:.:|
  Fly   829 GTVSQPILSAPSLARIAVGNW 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6583NP_609556.2 QVR 22..125 CDD:435716 7/24 (29%)
crokNP_609557.1 TFP_LU_ECD_Crok 22..125 CDD:467121
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.