DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6583 and CG31675

DIOPT Version :9

Sequence 1:NP_609556.2 Gene:CG6583 / 34645 FlyBaseID:FBgn0032420 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_724298.1 Gene:CG31675 / 318879 FlyBaseID:FBgn0051675 Length:148 Species:Drosophila melanogaster


Alignment Length:154 Identity:42/154 - (27%)
Similarity:64/154 - (41%) Gaps:37/154 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FLLLTLA----ICGSWAIRCYQCSSDQDRKGHDSCGAYKRFNRTEHISIEC---------NSDES 60
            :|||..|    :..::||:||.|.|..:.    |||  ..|....|...:|         .:|..
  Fly     4 YLLLFGALISLLASAYAIKCYACESVYEA----SCG--DDFEVENHFKYDCAFIAPPRFLENDLL 62

  Fly    61 HMPGSFCMKVVQQGPRGFIWDGRWRQVIRRC--ASVSDTGVVGVCNWGVYENGVYWEECY-CSSD 122
            .:..:.|:|      |.|..:| .|:::|.|  ..|:.|.|  .|......:.|....|: |.|:
  Fly    63 SVNATACLK------RVFKENG-VRKIVRGCYFGEVNATDV--WCKMDPTLSAVQNSSCHVCDSE 118

  Fly   123 S-CNGS-----SLVQMHGSLQLLL 140
            : ||||     ...::.|||.|.|
  Fly   119 NYCNGSENHPVDKWKIFGSLVLFL 142



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.