Sequence 1: | NP_609556.2 | Gene: | CG6583 / 34645 | FlyBaseID: | FBgn0032420 | Length: | 154 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_724298.1 | Gene: | CG31675 / 318879 | FlyBaseID: | FBgn0051675 | Length: | 148 | Species: | Drosophila melanogaster |
Alignment Length: | 154 | Identity: | 42/154 - (27%) |
---|---|---|---|
Similarity: | 64/154 - (41%) | Gaps: | 37/154 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 FLLLTLA----ICGSWAIRCYQCSSDQDRKGHDSCGAYKRFNRTEHISIEC---------NSDES 60
Fly 61 HMPGSFCMKVVQQGPRGFIWDGRWRQVIRRC--ASVSDTGVVGVCNWGVYENGVYWEECY-CSSD 122
Fly 123 S-CNGS-----SLVQMHGSLQLLL 140 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR33562 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |