DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31760 and CG31195

DIOPT Version :9

Sequence 1:NP_723730.2 Gene:CG31760 / 34642 FlyBaseID:FBgn0051760 Length:1093 Species:Drosophila melanogaster
Sequence 2:NP_732553.2 Gene:CG31195 / 46155 FlyBaseID:FBgn0051195 Length:807 Species:Drosophila melanogaster


Alignment Length:223 Identity:50/223 - (22%)
Similarity:80/223 - (35%) Gaps:83/223 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 PNNY-----YKGWWTYPYFSCS--QSRWLVSYSIAIPPIGRHGL------RGFISIDIDVSTLRV 347
            ||:|     ..|:||.|.|.|.  ..:|||:|  |:|..|...|      :|.:::.:|:..|.:
  Fly   632 PNSYRAANIKHGYWTQPQFDCDGYVKKWLVTY--AVPFFGWDSLKVKLEFKGVVAVSMDMLQLDI 694

  Fly   348 NQCEAEPYPFGSRRQKMQQLQTHNRLGARRSLFLGSRMGAIDESTINDLQAFHSSHKCHRTSMVC 412
            |||....|                                       :..||.::|||...|..|
  Fly   695 NQCPDWYY---------------------------------------EPNAFKNTHKCDEQSSYC 720

  Fly   413 DYRQPSAETPTVTGGKLLTTLTGSSSWTRGSYQCLCRGGFYSLRHP-----DGFNGTIMEIAWQE 472
                    .|.:..|           :..|.|:|.|..|:   .:|     ..::|.::|..:|.
  Fly   721 --------VPIMGRG-----------YETGGYKCECLQGY---EYPFEDLITYYDGQLVEAEYQN 763

  Fly   473 QQDNISNYYSEVFKC-LPCAPGCDTCTG 499
            ...::...| ::||| |..|.|..:..|
  Fly   764 IVADVETRY-DMFKCRLAGASGLQSALG 790

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31760NP_723730.2 FU 486..>508 CDD:214589 6/15 (40%)
7tm_3 526..754 CDD:278433
CG31195NP_732553.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR32546
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.