DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr33a and Gr68a

DIOPT Version :9

Sequence 1:NP_525102.4 Gene:Gr33a / 34641 FlyBaseID:FBgn0032416 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster


Alignment Length:203 Identity:44/203 - (21%)
Similarity:73/203 - (35%) Gaps:39/203 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 LDTSNDEDEDDFDYDNATIAENTGNTSEANLPDLFKLHDKILALSVITNGEFGPQCVPYMAACFV 333
            |||.|.:|....:                |..:|..|.:.:.....||.   ...||..::..|.
  Fly   203 LDTFNLQDCGHME----------------NWRELSNLIEVLCKFRYITE---NINCVAGVSLLFY 248

  Fly   334 VSIFGIFLETKVNFI---------VGGKSRLLDYMTYLYVIWSFTTMMVAYIVLRLCCNANNHSK 389
            .. |..:..|..:::         :..|:.:.|.:. |..||.....:...::...|....:...
  Fly   249 FG-FSFYTVTNQSYLAFATLTAGSLSSKTEVADTIG-LSCIWVLAETITMIVICSACDGLASEVN 311

  Fly   390 QSAMIVHEIMQKKPAFMLSNDLFYNKMKSFTLQFLHWEGFFQFNGVGLFALDYTFIFSTVSAATS 454
            .:|.|:..|..|...|....|.|..|.....|         ||...|.|::|.:.:|...||.|:
  Fly   312 GTAQILARIYGKSKQFQNLIDKFLTKSIKQDL---------QFTAYGFFSIDNSTLFKIFSAVTT 367

  Fly   455 YLIVLLQF 462
            ||::|:||
  Fly   368 YLVILIQF 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr33aNP_525102.4 7tm_7 <289..465 CDD:303125 39/183 (21%)
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 44/203 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.