DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr33a and Gr59f

DIOPT Version :9

Sequence 1:NP_525102.4 Gene:Gr33a / 34641 FlyBaseID:FBgn0032416 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:463 Identity:83/463 - (17%)
Similarity:142/463 - (30%) Gaps:176/463 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YLLINLSHII---GLCLLDSCNSVCKLSSHLFMHLGAFLYLTITLLSLYRRKEFFQQFDARLNDI 105
            |.|::||.:|   ||.:|.|              ...|:.:|...:||          |..||.|
  Fly    63 YRLVHLSWMILWYGLFVLGS--------------YWEFVLVTTQRVSL----------DRYLNAI 103

  Fly   106 DAVIQ------------KCQRVAEMDKVKVTAVKHSVAY--------HFTWLFLFCVFTF---AL 147
            ::.|.            :|:..|......:.....:.||        .|..|.||.|..|   |:
  Fly   104 ESAIYVVHIFSIMLLTWQCRNWAPKLMTNIVTSDLNRAYTIDCNRTKRFIRLQLFLVGIFACLAI 168

  Fly   148 YYDV-RSLYLTFGNLAFIPFMVSSFPYLAGSIIQGEFIYHVSVISQRFEQINMLLEKINQEARHR 211
            :::: ...::.:.::..|...|  .|.:..||...::...:..|:.|..:   |.|.:.:|..|.
  Fly   169 FFNIWTHKFVVYRSILSINSYV--MPNIISSISFAQYYLLLQGIAWRQRR---LTEGLERELTHL 228

  Fly   212 HAPLTVFDIESEGKKERKTVTPITVMDGRTTTGFGNENKFAGEMKRQEGQQKNDDDDLDTSNDED 276
            |:|..     ||.:|.|                                                
  Fly   229 HSPRI-----SEVQKIR------------------------------------------------ 240

  Fly   277 EDDFDYDNATIAENTGNTSEANLPDLFKLHDKILALSVITNGEFGPQCVPYMAACFVVSIFGIFL 341
                             ...|||.|..|..::....|::.          ....||         
  Fly   241 -----------------MHHANLIDFTKAVNRTFQYSILL----------LFVGCF--------- 269

  Fly   342 ETKVNFIVGGKSRLLDYMTYL---------YVIWSFTTMMVAYIVLRLCCNANNHSKQSAMIVHE 397
               :||      .|:.::.|.         :..|....:.:|..|.::|  :..|..||....|.
  Fly   270 ---LNF------NLVLFLVYQGIENPSMADFTKWVCMLLWLAMHVGKVC--SILHFNQSIQNEHS 323

  Fly   398 IMQKKPAFMLSNDLFYNK-----MKSFTLQFLHWEGFFQFNGVGLFALDYTFIFSTVSAATSYLI 457
            ..    ..:||...:..|     :..|.:|..  ....|....|:..||..|:.:.:.|:..:.|
  Fly   324 TC----LTLLSRVSYARKDIQDTITHFIIQMR--TNVRQHVVCGVINLDLKFLTTLLVASADFFI 382

  Fly   458 VLLQFDMT 465
            .|||:|:|
  Fly   383 FLLQYDVT 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr33aNP_525102.4 7tm_7 <289..465 CDD:303125 36/189 (19%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 81/459 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.