DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr33a and Gr58b

DIOPT Version :9

Sequence 1:NP_525102.4 Gene:Gr33a / 34641 FlyBaseID:FBgn0032416 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_523808.2 Gene:Gr58b / 37502 FlyBaseID:FBgn0041238 Length:408 Species:Drosophila melanogaster


Alignment Length:169 Identity:40/169 - (23%)
Similarity:59/169 - (34%) Gaps:63/169 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 VVSIF-GIFLETKVNFIVGGKSRLLD--YMTYLYVI-WSFTTMMVAYIVLRLCCNA----NNHS- 388
            :.|.| ||||...:.|:|   .|:::  ||.|..|: |:|..|:....:..:.|..    ..|. 
  Fly    47 IYSFFVGIFLFLNLYFMV---PRIMEDGYMKYNIVLQWNFFVMLFLRAIAVVSCYGTLWLKRHKI 108

  Fly   389 -----------KQSAMIVHEIMQKK---------------------PAFMLSNDLFYNKMKSFTL 421
                       |:...|...|:.||                     .||:.|..|.|..:.....
  Fly   109 IQLYKYSLIYWKRFGHITRAIVDKKELLDLQESLARIMIRKIILLYSAFLCSTVLQYQLLSVINP 173

  Fly   422 Q-----------FLHW----EGFFQFNGVGLFALDYTFI 445
            |           |||:    .|||   || |..|::.|:
  Fly   174 QIFLAFCARLTHFLHFLCVKMGFF---GV-LVLLNHQFL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr33aNP_525102.4 7tm_7 <289..465 CDD:303125 40/169 (24%)
Gr58bNP_523808.2 7tm_7 12..385 CDD:285581 40/169 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.