DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr33a and Gr23a

DIOPT Version :9

Sequence 1:NP_525102.4 Gene:Gr33a / 34641 FlyBaseID:FBgn0032416 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster


Alignment Length:165 Identity:40/165 - (24%)
Similarity:73/165 - (44%) Gaps:17/165 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 DLFKLHDKILALSVITNGEFGPQCVPYMA---ACFVVSIFGIFLETKVNFIVGGKSRLLDYMTYL 362
            ||.:.::.:..|.|..||.||...:..:.   |.||.:.:.:|::.:..     ..|:...:..|
  Fly   212 DLKRRYNDLHYLFVRINGYFGGSLLTIIIVHFAIFVSNSYWLFVDIRTR-----PWRIYAILLNL 271

  Fly   363 YVIWSFTTMMVAYIVLRLCCNANNHSKQSAMIVHEIMQKKPAFMLSNDLFYNKMKSFTLQFLHWE 427
            ..|::....|.|  ....|..:.|..:|...::.::: |.....|.|||    :..|:||.||..
  Fly   272 GFIFNVALQMAA--ACWHCQQSYNLGRQIGCLISKLV-KPQGSKLYNDL----VSEFSLQTLHQR 329

  Fly   428 GFFQFNGVGLFALDYTFIFSTVSAATSYLIVLLQF 462
              |.......|:|:...:.|..:|..:||::|:||
  Fly   330 --FVVTAKDFFSLNLHLLSSMFAAVVTYLVILIQF 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr33aNP_525102.4 7tm_7 <289..465 CDD:303125 40/165 (24%)
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 38/163 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.