DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr33a and Gr2a

DIOPT Version :9

Sequence 1:NP_525102.4 Gene:Gr33a / 34641 FlyBaseID:FBgn0032416 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001162633.1 Gene:Gr2a / 31093 FlyBaseID:FBgn0265139 Length:428 Species:Drosophila melanogaster


Alignment Length:423 Identity:78/423 - (18%)
Similarity:148/423 - (34%) Gaps:131/423 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 HLGAFLYLTITLLSLYRRKEFFQQFDARLNDIDAVIQKCQRVAEMDKVKVTAVKHSVAYHFTWLF 138
            ||.|       ||....:::..:.|.|.|.:||.::.|..|| :::.:::. ::...:....|: 
  Fly    95 HLAA-------LLEALWQRQAQRGFFAELGEIDRLLSKALRV-DVEAMRIN-MRRQTSRRAVWI- 149

  Fly   139 LFCVFTFALY-YDVRSLYLTFGNL-----AFIPFMVSSFPYLAGSIIQGEFIYHVSVISQRFEQ- 196
                    |: |.|..|.:....|     .|..:.:|   ||...::.|...:.:...:|...| 
  Fly   150 --------LWGYAVSQLLILGAKLLSRGDRFPIYWIS---YLLPLLVCGLRYFQIFNATQLVRQR 203

  Fly   197 INMLLEKINQEARHRHAPLTVFDIESEGKKERKTVTPITVMDGRTTTGFGNENKFAGEMKRQEGQ 261
            :::||..:.|...|:..|.                                              
  Fly   204 LDVLLVALQQLQLHQKGPA---------------------------------------------- 222

  Fly   262 QKNDDDDLDTSNDEDEDDFDYDNATIAENTGNTSEANLPDLFK---LHDKILALSVITNGEFGPQ 323
                   :||..:|.||               ..||.:..|..   ::.::.||..:.|..:|..
  Fly   223 -------VDTVLEEQED---------------LEEAAMDRLIAVRLVYQRVWALVALLNRCYGLS 265

  Fly   324 CVPYMAACFVV---SIFGIFLETKVNFIVGGKSRLLDYMTYLYVIWSFTTMMVAYIVLRLCCNAN 385
            .:..:...|:.   :.:.:||    ||.....|...........:||...:....::..||....
  Fly   266 MLMQVGNDFLAITSNCYWMFL----NFRQSAASPFDILQIVASGVWSAPHLGNVLVLSLLCDRTA 326

  Fly   386 NHSKQSAMIVHEIMQKKPAFMLSND------------------LFYNKMKSFTLQFLHWEGFFQF 432
            ..:.:.|:.:|::     :..|.|:                  |...::..|:||.||..  ..|
  Fly   327 QCASRLALCLHQV-----SVDLRNESHNALVGTLVRYCAPLIILVPLQITQFSLQLLHQR--LHF 384

  Fly   433 NGVGLFALDYTFIFSTVSAATSYLIVLLQFDMT 465
            :..|.|.:|.|.:::.|.|.|:|||:|:||.|:
  Fly   385 SAAGFFNVDCTLLYTIVGATTTYLIILIQFHMS 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr33aNP_525102.4 7tm_7 <289..465 CDD:303125 41/199 (21%)
Gr2aNP_001162633.1 7tm_7 7..418 CDD:285581 78/423 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.