DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr33a and lite-1

DIOPT Version :9

Sequence 1:NP_525102.4 Gene:Gr33a / 34641 FlyBaseID:FBgn0032416 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_509043.3 Gene:lite-1 / 180894 WormBaseID:WBGene00001803 Length:439 Species:Caenorhabditis elegans


Alignment Length:216 Identity:49/216 - (22%)
Similarity:80/216 - (37%) Gaps:77/216 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 EANLPD--LFKLHDKILALSVITNGE--------------FGPQCVPYMAACFVVSIFGIFLETK 344
            |..||:  |.|:||..::...|.||:              :| .|:|..  ||::          
 Worm   257 ECPLPESSLQKIHDCQISYQRIFNGKAVIEEYYSFVLFYSYG-VCIPIF--CFLM---------- 308

  Fly   345 VNFIVGGKSRLLDYMTYLYVIWSFTTMMVAYIVLRLCCNANNHSKQSAMIVHEIMQKKPAFMLSN 409
               .||        |:...:.||....:|.:||     ||         |:..::...||||::.
 Worm   309 ---FVG--------MSAQSICWSEVVSIVIWIV-----NA---------ILVLLLFSLPAFMINE 348

  Fly   410 D---LFYNKMKSF--------TLQFLHWEGFFQF---------NGVGLFALDYTFIFSTVSAATS 454
            |   |..:..:.:        .|..|....||.|         :....|.:|.:.:.|..||..:
 Worm   349 DGDRLVASSFRMYHETFHEERDLTVLSQMTFFTFQIHSTKLTLSACNYFYMDRSILLSLFSAILT 413

  Fly   455 YLIVLLQFDMTAILRNEGLMS 475
            |.::|.:||   |..|:.|.:
 Worm   414 YFLILWEFD---IKNNQSLQN 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr33aNP_525102.4 7tm_7 <289..465 CDD:303125 46/204 (23%)
lite-1NP_509043.3 7tm_7 75..425 CDD:285581 47/208 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.