DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr33a and Gr22e

DIOPT Version :9

Sequence 1:NP_525102.4 Gene:Gr33a / 34641 FlyBaseID:FBgn0032416 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_722731.1 Gene:Gr22e / 117498 FlyBaseID:FBgn0045497 Length:389 Species:Drosophila melanogaster


Alignment Length:181 Identity:42/181 - (23%)
Similarity:75/181 - (41%) Gaps:26/181 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 GNTSEANLPD-LFKLHDKILALSVITNGEFGPQCVPYMAACFVVSIFGIFLETKVNFIVGGKS-- 353
            |.|.|:...| |..|:.::|.|.......:..|.|..|.:..:.::.||:.     ||:...|  
  Fly   222 GETVESERMDLLLYLYHRLLDLGQRLASIYDYQMVMVMVSFLIANVLGIYF-----FIIYSISLN 281

  Fly   354 RLLDYMTYLYVIWSFTTMMVAYIVLRLCCNANNHSKQSAMIVHEIMQKKPAFMLSNDL------F 412
            :.||:...::|......|:..::.:.:|..|....:|::.|:          .|.||:      .
  Fly   282 KSLDFKILVFVQALVINMLDFWLNVEICELAERTGRQTSTIL----------KLFNDIENIDEKL 336

  Fly   413 YNKMKSFTLQFLHWEGFFQFNGVGLFALDYTFIFSTVSAATSYLIVLLQFD 463
            ...:..|.|...|..  .:|:..|||.::|...|.....:..||:.|:|||
  Fly   337 ERSITDFALFCSHRR--LRFHHCGLFYVNYEMGFRMAITSFLYLLFLIQFD 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr33aNP_525102.4 7tm_7 <289..465 CDD:303125 42/181 (23%)
Gr22eNP_722731.1 7tm_7 18..388 CDD:285581 42/181 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.