DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr33a and Gr92a

DIOPT Version :9

Sequence 1:NP_525102.4 Gene:Gr33a / 34641 FlyBaseID:FBgn0032416 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster


Alignment Length:168 Identity:40/168 - (23%)
Similarity:78/168 - (46%) Gaps:14/168 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CNSVCKLSSHLFMHLGAFLYLTITLLSLYRRKEFFQQFDARLNDID--AVIQKCQRVAEMDKVKV 123
            |:.....::::|:|:.:..||::.:|.....|..:.....:|..::  ...||.:||  .::::.
  Fly   176 CDFYLVSATNIFIHINSIGYLSLGVLYSELNKYVYTNLRIQLQKLNTSGSKQKIRRV--QNRLEK 238

  Fly   124 TAVKHSVAYHFTWLF--LFCVFTF-ALYYDVRSLYLTFGNLAFIPFMVSSFPY--LAGSIIQGEF 183
            ....:...||.:.:|  ||....| ||.|.|..:.|...|:| :.|.::||.:  |.|..:...|
  Fly   239 CISLYREIYHTSIMFHKLFVPLLFLALIYKVLLIALIGFNVA-VEFYLNSFIFWILLGKHVLDLF 302

  Fly   184 IYHVSV---ISQRFEQINMLLEKINQEARHRHAPLTVF 218
            :..|||   ::| |..|.|....:...::.:....|:|
  Fly   303 LVTVSVEGAVNQ-FLNIGMQFGNVGDLSKFQTTLDTLF 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr33aNP_525102.4 7tm_7 <289..465 CDD:303125
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 40/168 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.