DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr33a and Gr28a

DIOPT Version :9

Sequence 1:NP_525102.4 Gene:Gr33a / 34641 FlyBaseID:FBgn0032416 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_523504.2 Gene:Gr28a / 117348 FlyBaseID:FBgn0041247 Length:450 Species:Drosophila melanogaster


Alignment Length:491 Identity:106/491 - (21%)
Similarity:183/491 - (37%) Gaps:118/491 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FSMVIGLIP----LN-RQQSETNFILDYAMMCIVPIFYVACYLLINLS-----HIIGLCLLDSCN 62
            |..::||.|    || |::.:|:....:|.: :..:|:|.|:   .:|     .|||....   .
  Fly    24 FISLLGLAPFRLNLNPRKEVQTSKFSFFAGI-VHFLFFVLCF---GISVKEGDSIIGYFFQ---T 81

  Fly    63 SVCKLSSHLFMHLGAFLYLTITLLSLYRRKEFFQQFDARLNDIDAVIQKCQRVAEMDKVKVTAVK 127
            ::.:.|.......|.....||...::::|:.              ::...|....:|::.| .:.
  Fly    82 NITRFSDGTLRLTGILAMSTIFGFAMFKRQR--------------LVSIIQNNIVVDEIFV-RLG 131

  Fly   128 HSVAYHFTWLFLFCVFTFALYYDVRSLYLTFGNL-------AFIPFMVSSFPYLAGSIIQGEFIY 185
            ..:.|....|..|.:....|.::|..|.:::..|       :|:.|...:.|::..|::..:|:.
  Fly   132 MKLDYRRILLSSFLISLGMLLFNVIYLCVSYSLLVSATISPSFVTFTTFALPHINISLMVFKFLC 196

  Fly   186 HVSVISQRFEQINMLLEKI----------------NQEARHRHAPLTVFDIESEGKKERKTVTPI 234
            ...:...||..:|.:|:.|                :....||.....:.::.|...| |.:||.:
  Fly   197 TTDLARSRFSMLNEILQDILDAHIEQLSALELSPMHSVVNHRRYSHRLRNLISTPMK-RYSVTSV 260

  Fly   235 TVMDGRTTTGFGNENKFAGEMKRQEGQQKNDDDDLDTSNDEDEDDFDYDNATIAENTGNTSEANL 299
            ..::          .::|.:      |..|..:.|.......|:.|.|....|..         :
  Fly   261 IRLN----------PEYAIK------QVSNIHNLLCDICQTIEEYFTYPLLGIIA---------I 300

  Fly   300 PDLFKLHDKILALSVITNGEFGPQCVPYMAACFVVSIFGIFLETKVNFIVGGKSRLLDYMTYLYV 364
            ..||.|.|....|..|.|    |:.:....|   ...|..||...:.:||         :..|.|
  Fly   301 SFLFILFDDFYILEAILN----PKRLDVFEA---DEFFAFFLMQLIWYIV---------IIVLIV 349

  Fly   365 IWSFTTMMVAYIVLRLCCNANNHSKQSAMIVHEIMQKKPAFMLSNDLFYNKMKSFTLQFLHWEGF 429
            ..|..|::              ||..:|.|||:|:.......|.:.||     ..:||..|.:  
  Fly   350 EGSSRTIL--------------HSSYTAAIVHKILNITDDPELRDRLF-----RLSLQLSHRK-- 393

  Fly   430 FQFNGVGLFALDYTFIFSTVSAATSYLIVLLQFDMT 465
            ..|...|||.||.|.||:...|||.|||:|:||..|
  Fly   394 VLFTAAGLFRLDRTLIFTITGAATCYLIILIQFRFT 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr33aNP_525102.4 7tm_7 <289..465 CDD:303125 49/175 (28%)
Gr28aNP_523504.2 7tm_7 22..430 CDD:285581 106/491 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.