DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr33a and Gr39b

DIOPT Version :9

Sequence 1:NP_525102.4 Gene:Gr33a / 34641 FlyBaseID:FBgn0032416 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster


Alignment Length:488 Identity:89/488 - (18%)
Similarity:170/488 - (34%) Gaps:160/488 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MNWFSMVIGLIPLNRQQSETNFILDYAMMCIVPIFYVACYLLINLSHIIGLCLLDSCNSVCKLSS 69
            :.:|:: :||:|.:...:::.|         |...|.|..:::|.                    
  Fly     9 LKYFAL-LGLVPWSESCAQSKF---------VQKVYSAILIILNA-------------------- 43

  Fly    70 HLFMHLGAFLYLTITLLSLYRRKEFFQQFDARLNDIDAVIQKCQRVAEMDKVKVTAVKHSVAYHF 134
               :|.|..:|             |.|..:..|:.:..||....|:     |.||.:...|..|:
  Fly    44 ---VHFGISIY-------------FPQSAELFLSLMVNVIVFVARI-----VCVTVIILQVMVHY 87

  Fly   135 TWLFLFCVFTFALYYDVR---SLYLTFGNLAF----------IPFMVSSFP--YLAGSIIQGEFI 184
            ...|.||  ....|..:|   .|.:..|.|.:          |.|:|:..|  |:|   :.|..:
  Fly    88 DDYFRFC--REMKYLGLRLQCELKIHVGRLKWQSYAKILALGIGFLVTVLPSIYVA---LSGSLL 147

  Fly   185 YH-VSVISQRFEQINMLLEKINQEARHRHAPLTVFDIESEGKKERKTVTPITVMDGRTTTGFGNE 248
            |. .|::|....::..:|..:|.|....|..|....:::        |....:| |...|..||.
  Fly   148 YFWSSLLSILIIRMQFVLVLLNVELLGHHVSLLGIRLQN--------VLECHLM-GANCTLDGNA 203

  Fly   249 NK-----FAGEMKRQEGQQKNDDDDLDTSNDEDEDDFDYDNATIAENTGNTSEANLPDLFKLHDK 308
            |:     |...:|:                                     |...|..||...:.
  Fly   204 NRLCSLEFLLALKQ-------------------------------------SHMQLHYLFTHFND 231

  Fly   309 ILALSVITNGEFGPQCVPYMAACFVVSIFGIFLETKVNFIVGGKSRLLDYMTYLYVIWSFTTMMV 373
            :...|::              ..:||    :|.::.|| |...:..|::...|.|:..:|:..:.
  Fly   232 LFGWSIL--------------GTYVV----LFSDSTVN-IYWTQQVLVEVYEYKYLYATFSVFVP 277

  Fly   374 AYIVLRLCCNANNHSKQSAMIV---------HEIMQKKPAFMLSNDLFYNKMKSFTLQFLHWEGF 429
            ::..:.:.|......::.::::         |..:.::.::   .||    :..|.||.  .:..
  Fly   278 SFFNILVFCRCGEFCQRQSVLIGSYLRNLSCHPSIGRETSY---KDL----LMEFILQV--EQNV 333

  Fly   430 FQFNGVGLFALDYTFIFSTVSAATSYLIVLLQF 462
            ...|..|..:.|.:.:.|.::|..:|||||:||
  Fly   334 LAINAEGFMSTDNSLLMSILAAKVTYLIVLMQF 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr33aNP_525102.4 7tm_7 <289..465 CDD:303125 34/183 (19%)
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 89/488 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.