DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and RHBDL1

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_024306253.1 Gene:RHBDL1 / 9028 HGNCID:10007 Length:526 Species:Homo sapiens


Alignment Length:149 Identity:42/149 - (28%)
Similarity:64/149 - (42%) Gaps:23/149 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 RKRLWRVPWFILLMSFVQISL---------HWIAS----ECMQKVLIFKPEWNVEYWRLLTYMLL 116
            |.|....|.|:..::..||.:         .|:..    |.|:..|::.|......||.||||.:
Human   190 RHRSCPPPVFMASVTLAQIIVFLCYGARLNKWVLQTYHPEYMKSPLVYHPGHRARAWRFLTYMFM 254

  Fly   117 HSDYWHLSLNICFQCFIGICLEVEQGHWRLAVVYMVGGVAGSLANAWLQPHLHLMGASAGVYAML 181
            |.....|..|...|..||:.||:..|..|::::|:.|.:||. |.|..:|   |...:|...|..
Human   255 HVGLEQLGFNALLQLMIGVPLEMVHGLLRISLLYLAGVLAGE-AGAHPRP---LPWPAAPSPAAC 315

  Fly   182 GSHVPHLVLNFSQLSHRFA 200
            ...:|      ::|.||.|
Human   316 SHRLP------NRLHHRHA 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 31/95 (33%)
RHBDL1XP_024306253.1 Rhomboid 239..>295 CDD:328780 19/55 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.