DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and PCP1

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_011615.1 Gene:PCP1 / 852993 SGDID:S000003333 Length:346 Species:Saccharomyces cerevisiae


Alignment Length:218 Identity:48/218 - (22%)
Similarity:80/218 - (36%) Gaps:59/218 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LWRVP--WFILLMSFVQISLHWIASECMQKVLIFKPEWNVEYWRLLTYMLLHSDYWHLSLNICFQ 130
            ||::|  |..|                 ||.::.:.::......::.....|.::|||.:|:...
Yeast   159 LWQLPKCWRFL-----------------QKYMLLQKDYVTSKISIIGSAFSHQEFWHLGMNMLAL 206

  Fly   131 CFIGICLEVEQGHWRLAVVYMVGGVAGSLANAWLQPHLHL------MGASAGVYAMLG--SHV-P 186
            ...|..|....|......:||...:||||.:.|......|      :|||..::.:||  |:: |
Yeast   207 WSFGTSLATMLGASNFFSLYMNSAIAGSLFSLWYPKLARLAIVGPSLGASGALFGVLGCFSYLFP 271

  Fly   187 HLVLNFSQLSHRFARIASLLILLLSDVGFTTYHFCHNHNRNP--------RTSLEAHIGGGVAGI 243
            |               |.:|:.:....|.....|..:...|.        .....||:||.:.|:
Yeast   272 H---------------AKILLFVFPVPGGAWVAFLASVAWNAAGCALRWGSFDYAAHLGGSMMGV 321

  Fly   244 LCGFIV--------YRRLQPANQ 258
            |.|:.:        .||||.|.:
Yeast   322 LYGWYISKAVEKQRQRRLQAAGR 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 36/169 (21%)
PCP1NP_011615.1 Rhomboid 186..329 CDD:396315 36/157 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.