DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and KOM

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001321009.1 Gene:KOM / 844122 AraportID:AT1G77860 Length:385 Species:Arabidopsis thaliana


Alignment Length:245 Identity:55/245 - (22%)
Similarity:106/245 - (43%) Gaps:57/245 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RRKRLWRVPWFILLMSFVQISLHWIA-----------SECMQKVL------------IFKP---- 101
            |.:::.|..|.:.:...:||.|..:.           ..|..|:|            :..|    
plant    40 RSRQIKRDTWLVSVFVLLQIVLFAVTMGVNDCSGNSHGHCSAKLLGRFSFQSLSENPMLGPSAST 104

  Fly   102 -------EW-----NVEYWRLLTYMLLHSDYWHLSLNICFQCFIGICLEVEQGHWRLAVVYMVGG 154
                   .|     |.|.||:||...|||..:||.:|:....|:||.:|.:.|..|:||:|.:.|
plant   105 LEHMGGLSWKALTENHEIWRILTSPWLHSGLFHLFINLGSLIFVGIYMEQQFGPLRIAVIYFLSG 169

  Fly   155 VAGSLANAWLQPHLHLMGASAGVYAMLGSHVPHLVLNFSQLSHRFARIASLLILLLSD--VGFTT 217
            :.|||.......::..:.:.|..:.::|:.:..|..|::..:.:.:.:|.:..:...:  :||..
plant   170 IMGSLFAVLFVRNIPSISSGAAFFGLIGAMLSALAKNWNLYNSKISALAIIFTIFTVNFLIGFLP 234

  Fly   218 YHFCHNHNRNPRTSLEAHIGGGVAGILCGFIV-----YRRLQPANQKAIY 262
              |..|.         |:|||.::|.|.||::     .|::.|:::..::
plant   235 --FIDNF---------ANIGGFISGFLLGFVLLFKPQLRQMPPSHKGKLF 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 41/151 (27%)
KOMNP_001321009.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.