DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and RBL5

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_175667.1 Gene:RBL5 / 841690 AraportID:AT1G52580 Length:309 Species:Arabidopsis thaliana


Alignment Length:225 Identity:57/225 - (25%)
Similarity:99/225 - (44%) Gaps:51/225 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 WRVPWFILLMSFVQISLHWIASECMQKV-----------LIFKP-EWNV---------------- 105
            |.|| .||..:||..:.....::|..:.           |.|:| :.|:                
plant    34 WLVP-LILAANFVTFATTMYVNDCPARSDECLLFDVLGRLSFQPIKENMLLGPSIPTLRKLGALE 97

  Fly   106 -------EYWRLLTYMLLHSDYWHLSLNICFQCFIGICLEVEQGHWRLAVVYMVGGVAGSLANAW 163
                   |.|||::.:.||..:.||..|:.....||:.||.|.|..|:..:|::.|:.|||.:..
plant    98 RRLVEEGERWRLISCIWLHGGFLHLMANMISLMCIGMRLEQEFGFMRIGALYVISGLGGSLVSCL 162

  Fly   164 L--QPHLHLMGASAGVYAMLGSHVPHLVLNFSQLSHRFARIASLLILLLSD--VGFTTYHFCHNH 224
            .  |.....:|||..::.:||:.:..|:.|::...::...:.:|:::::.:  |||.        
plant   163 TDSQGERVSVGASGALFGLLGAMLSELITNWTIYENKCTALMTLILIIVLNLSVGFL-------- 219

  Fly   225 NRNPRTSLEAHIGGGVAGILCGFIVYRRLQ 254
               ||....||.||.:||...||::..|.|
plant   220 ---PRVDNSAHFGGFLAGFFLGFVLLLRPQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 43/148 (29%)
RBL5NP_175667.1 Rhomboid 104..246 CDD:366759 44/152 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.